Ÿ GPCR - 2012”Nƒm[ƒxƒ‹‰ťŠwÜiJmol”Łj Ÿ
¨ ‹Œ”ŁiXV‚ľ‚Ü‚š‚ńj Š
Ś–{ƒy[ƒW‚Ě•ŞŽqƒ‚ƒfƒ‹‚ÍInternet Explorer‚ĹŽQĆ‚Ĺ‚Ť‚Ü‚ˇBMicrosoft Edge‚Ĺ‚ÍInternet Explorerƒ‚[ƒh‚É‚ľ‚āB
ŚPDBsumƒf[ƒ^‚Ĺƒtƒ@ƒCƒ‹–ź*_lp‚Ĺ‚ ‚é‚ŕ‚Ě‚ÍLigPlot+ v.2.2‚ĹŽć“ž‚ľ‚˝‚ŕ‚Ě‚Ĺ‚ˇB

Žó—e‘ĚŠÖ˜A(1)FMRGPRX2`ƒAƒfƒmƒVƒ“Žó—e‘ĚŠÖ˜A b Žó—e‘ĚŠÖ˜A(2)FƒAƒhƒŒƒiƒŠƒ“Žó—e‘́`GABABŽó—e‘ĚŠÖ˜A
Žó—e‘ĚŠÖ˜A(3)FƒJƒ“ƒiƒrƒmƒCƒhŽó—e‘ĚŠÖ˜A`ƒZƒNƒŒƒ`ƒ“Žó—e‘ĚŠÖ˜A b Žó—e‘ĚŠÖ˜A(4)FƒZƒƒgƒjƒ“Žó—e‘ĚŠÖ˜A`
ƒƒhƒvƒVƒ“ŠÖ˜A b ‚ť‚Ě‘ź a ŽQlŽ‘—ż b ƒjƒ…[ƒXi•Ęƒy[ƒW‚Ɉڍsj

œŽó—e‘ĚŠÖ˜A (1)

ƒAƒ~ƒmF@ChainF@CPKF@a@JmolF@RasmolF a ”ZÔ@—΁@”Zƒsƒ“ƒN@žň
Ž_ŤE’†ŤE‰–ŠîŤ‹ć•Ę@‹ÉŤE”ń‹ÉŤ‹ć•Ę@‘a…ŤƒCƒ“ƒfƒbƒNƒX‡@I/O’l‡i“ÁŤŠî Rj@“™“d“_‡@ƒRƒ“ƒzƒ[ƒVƒ‡ƒ“‘I‘𐍁iƒżƒwƒŠƒbƒNƒXEƒŔƒXƒgƒ‰ƒ“ƒhj
…‘fŒ‹‡•\ŽŚ b S-SŒ‹‡•\ŽŚ@ b @
b ”wŒiE•@ŠD@”’@Ž
@Chain‘I‘đF A B C D E F G H I J K L M N O P
7s8o‚ĚChain RiMRGPRX2G(R)-Zinc-3573‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7s8o_8IU$ b PDBsumƒf[ƒ^7s8n_8IU$@mMRGPRX2 - Wikipedian
7vv6iMRGPRX2GC48/80‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7vv6_6IB$ b PDBsumƒf[ƒ^7vv5_6IB$@PDBsumƒf[ƒ^7vdh_6IB$
5cxviƒ€ƒXƒJƒŠƒ“ŤƒAƒZƒ`ƒ‹ƒRƒŠƒ“Žó—e‘ĚM1GƒAƒ“ƒ^ƒSƒjƒXƒg‚Ěƒ`ƒIƒgƒƒsƒEƒ€Œ‹‡CKobilka‚ç‚É‚ć‚éj@0HKiƒ`ƒIƒgƒƒsƒEƒ€j‘I‘đ@“ŻPDBsumƒf[ƒ^5cxv_0HK$@mMuscarinic acetylcholine receptor - Wikipedian
6wjciƒ€ƒXƒJƒŠƒ“ŤƒAƒZƒ`ƒ‹ƒRƒŠƒ“Žó—e‘ĚM1Gmuscarinic toxin 7‚ĆƒAƒgƒƒsƒ“Œ‹‡CKobilka‚ç‚É‚ć‚éj@Chain Cimuscarinic toxin 7j‘I‘đ@OINiƒAƒgƒƒsƒ“j‘I‘đ@“ŻPDBsumƒf[ƒ^6wjc_OIN$@mMuscarinic toxin 7 - Wikipedian
6zfziƒ€ƒXƒJƒŠƒ“ŤƒAƒZƒ`ƒ‹ƒRƒŠƒ“Žó—e‘ĚM1G77-LH-28-1Œ‹‡j@QJTi77-LH-28-1j‘I‘đ@“ŻPDBsumƒf[ƒ^6zfz_QJT$@m77-LH-28-1 - Wikipedian
5yc8iƒ€ƒXƒJƒŠƒ“ŤƒAƒZƒ`ƒ‹ƒRƒŠƒ“Žó—e‘ĚM2GƒAƒ“ƒ^ƒSƒjƒXƒg‚ĚN-ƒƒ`ƒ‹ƒXƒRƒ|ƒ‰ƒ~ƒ“Œ‹‡j@“ŻPDBsumƒf[ƒ^5yc8_3C0$ a PDBsumƒf[ƒ^5zk8_3C0$@PDBsumƒf[ƒ^5zkc_3C0$@PDBsumƒf[ƒ^5zk3_QNB$@PDBsumƒf[ƒ^5zkb_82F$
6u1n‚ĚChain CERiƒ€ƒXƒJƒŠƒ“ŤƒAƒZƒ`ƒ‹ƒRƒŠƒ“Žó—e‘ĚM2GƒŔƒAƒŒƒXƒ`ƒ“1‚ĆƒAƒSƒjƒXƒgŒ‹‡j@Chain CiƒŔƒAƒŒƒXƒ`ƒ“1j‘I‘đ@2CUiƒAƒSƒjƒXƒgj‘I‘đ@“ŻPDBsumƒf[ƒ^6u1n_2CU$
7t94‚ĚChain Aiƒ€ƒXƒJƒŠƒ“ŤƒAƒZƒ`ƒ‹ƒRƒŠƒ“Žó—e‘ĚM2GƒAƒSƒjƒXƒgLY2119620Œ‹‡CKobilka‚ç‚É‚ć‚éj@2CUiƒAƒSƒjƒXƒgj‘I‘đ@“ŻPDBsumƒf[ƒ^7t94_lp$
4daj‚ĚChain Aiƒ€ƒXƒJƒŠƒ“ŤƒAƒZƒ`ƒ‹ƒRƒŠƒ“Žó—e‘ĚM3Gƒ`ƒIƒgƒƒsƒEƒ€Œ‹‡CKobilka‚ç‚É‚ć‚éj@“ŻPDBsumƒf[ƒ^4daj_0HK$
5zhp‚ĚChain Aiƒ€ƒXƒJƒŠƒ“ŤƒAƒZƒ`ƒ‹ƒRƒŠƒ“Žó—e‘ĚM3GƒAƒ“ƒ^ƒSƒjƒXƒgŒ‹‡CKobilka‚ç‚É‚ć‚éj@“ŻPDBsumƒf[ƒ^5zhp_9EC$
5dsg‚ĚChain Aiƒ€ƒXƒJƒŠƒ“ŤƒAƒZƒ`ƒ‹ƒRƒŠƒ“Žó—e‘ĚM4GƒCƒ“ƒo[ƒXƒAƒSƒjƒXƒg‚Ěƒ`ƒIƒgƒƒsƒEƒ€Œ‹‡CKobilka‚ç‚É‚ć‚éj@0HKiƒ`ƒIƒgƒƒsƒEƒ€j‘I‘đ@“ŻPDBsumƒf[ƒ^5dsg_0HK$
7trp‚ĚChain Riƒ€ƒXƒJƒŠƒ“ŤƒAƒZƒ`ƒ‹ƒRƒŠƒ“Žó—e‘ĚM4GƒCƒyƒ‹ƒIƒLƒ\qiperoxor‚ĆLY2033298Œ‹‡j@“ŻPDBsumƒf[ƒ^7trp_IXO_lpiƒCƒyƒ‹ƒIƒLƒ\qiperoxorj$@“ŻPDBsumƒf[ƒ^7trp_IUE_lpiLY2033298j$ b PDBsumƒf[ƒ^7trq_IUI_lpiVU0467154j$
7v6a‚ĚChain Riƒ€ƒXƒJƒŠƒ“ŤƒAƒZƒ`ƒ‹ƒRƒŠƒ“Žó—e‘ĚM4j@“ŻPDBsumƒf[ƒ^7v6aR_lp$
8fx5‚ĚChain Riƒ€ƒXƒJƒŠƒ“ŤƒAƒZƒ`ƒ‹ƒRƒŠƒ“Žó—e‘ĚM4GƒAƒSƒjƒXƒg‚ĚƒLƒTƒmƒƒŠƒ“qxanomelinerŒ‹‡j@“ŻPDBsumƒf[ƒ^8fx5_XNO[501(R)]$
5uen‚ĚChain AiƒAƒfƒmƒVƒ“A1Žó—e‘́GƒAƒSƒjƒXƒgDU172Œ‹‡j@DU1iDU172j‘I‘đ@“ŻPDBsumƒf[ƒ^5uen_DU1$@mAdenosine receptor - WikipediaCAdenosine A1 receptor - Wikipedian
7ld3‚ĚChain RiƒAƒfƒmƒVƒ“A1Žó—e‘́GMIPS521‚ĆƒAƒfƒmƒVƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7ld3_XTDiMIPS521j$@“ŻPDBsumƒf[ƒ^7ld3_ADNiƒAƒfƒmƒVƒ“j$ b PDBsumƒf[ƒ^7ld4_ADNiƒAƒfƒmƒVƒ“j$
3eml%iƒAƒfƒmƒVƒ“A2AŽó—e‘́GƒAƒ“ƒ^ƒSƒjƒXƒgZM241385Œ‹‡j@ZMAiZM241385j‘I‘đ@“ŻPDBsumƒf[ƒ^3eml_ZMA$@mAdenosine A2A receptor - Wikipedian
3pwhiƒAƒfƒmƒVƒ“A2AŽó—e‘́kMutation: A54L, T88A, R107A, K122A, L202A, L235A, V239A, S277AlGƒAƒ“ƒ^ƒSƒjƒXƒgZM241385Œ‹‡j@“ŻPDBsumƒf[ƒ^3pwh_ZMA$
5uviiƒAƒfƒmƒVƒ“A2AŽó—e‘́kMutation: M1007W, H1102I, R1106LlGZM241385Œ‹‡j@“ŻPDBsumƒf[ƒ^5uvi_ZMA$
5g53‚ĚChain AECiƒAƒfƒmƒVƒ“A2AŽó—e‘́Gmini-Gs‚ĆƒAƒSƒjƒXƒgNECA‚ŞŒ‹‡j@NECA‘I‘đ@GDP‘I‘đ@“ŻPDBsumƒf[ƒ^5g53_NECiNECAj$
5iu4iƒAƒfƒmƒVƒ“A2AŽó—e‘́GZM241385Œ‹‡j@“ŻPDBsumƒf[ƒ^5iu4_ZMAi4-{2-[(7-amino-2-furan-2-yl[1,2,4]triazolo[1,5- a][1,3,5]triazin-5-yl)amino]ethyl}phenolj$@a@ˆČ‰ş‚Í“ŻŽžŒöŠJƒf[ƒ^‚ĚPDBsumƒf[ƒ^F@5iu7_6DYi2-(furan-2-yl)-N~5~-[2-(4-phenylpiperidin-1-yl) ethyl][1,2,4]triazolo[1,5-a][1,3,5]triazine-5,7- diaminej$ b 5iu8_6DZi2-(furan-2-yl)-N~5~-[2-(4-methylpiperazin-1-yl) ethyl][1,2,4]triazolo[1,5-a][1,3,5]triazine-5,7- diaminej$ b 5iua_6DXi2-(furan-2-yl)-N~5~-[3-(4-phenylpiperazin-1-yl) propyl][1,2,4]triazolo[1,5-a][1,3,5]triazine-5,7- diaminej$ b 5iub_6DViN~5~-{2-[4-(2,4-difluorophenyl)piperazin-1-yl]ethyl}-2- (furan-2-yl)[1,2,4]triazolo[1,5-a][1,3,5]triazine-5,7- diaminej$
5k2aiƒAƒfƒmƒVƒ“A2AŽó—e‘́GZM241385Œ‹‡j@“ŻPDBsumƒf[ƒ^5k2a_ZMA$@a@ˆČ‰ş‚Í“ŻŽžŒöŠJƒf[ƒ^‚ĚPDBsumƒf[ƒ^iƒŠƒKƒ“ƒh‚͉˝‚ę‚ŕZM241385jF@5k2b_ZMA$ b 5k2c_ZMA$ b 5k2d_ZMA$
5wf5iƒAƒfƒmƒVƒ“A2AŽó—e‘́GƒAƒSƒjƒXƒgŒ‹‡j@UKAiƒAƒSƒjƒXƒgj‘I‘đ@“ŻPDBsumƒf[ƒ^5wf5_UKA$ a PDBsumƒf[ƒ^5wf6_UKA$
6s0qiƒAƒfƒmƒVƒ“A2AŽó—e‘́GZM241385Œ‹‡j@“ŻPDBsumƒf[ƒ^6s0q_ZMA$ b 6s0l_ZMA$
6zdriƒAƒfƒmƒVƒ“A2AŽó—e‘́GƒAƒ“ƒ^ƒSƒjƒXƒgŒ‹‡j@QGEiƒAƒ“ƒ^ƒSƒjƒXƒgcompound 4dj‘I‘đ@“ŻPDBsumƒf[ƒ^6zdr_QGE$ b PDBsumƒf[ƒ^6zdv_QGWicompound 5dj$
7ezc‚ĚChain AiƒAƒfƒmƒVƒ“A2AŽó—e‘́GƒAƒSƒjƒXƒgUK-432097Œ‹‡j@“ŻPDBsumƒf[ƒ^7ezcA_lp$
8wdt‚ĚChain AiƒAƒfƒmƒVƒ“A2AŽó—e‘́GphotoNECA (blue)Œ‹‡j@“ŻPDBsumƒf[ƒ^8wdt_lp$
6k41‚ĚChain RiƒAƒfƒmƒVƒ“A2BŽó—e‘́GƒfƒNƒXƒƒfƒgƒ~ƒWƒ“Œ‹‡CKobilka‚ç‚É‚ć‚éj@“ŻPDBsumƒf[ƒ^6k41_CZX$ b PDBsumƒf[ƒ^6k42_CZX$@mAdenosine A2B receptor - WikipediaCDexmedetomidine - Wikipedian
7xy7‚ĚChain RiƒAƒfƒmƒVƒ“A2BŽó—e‘́GƒAƒSƒjƒXƒgNECAŒ‹‡j@“ŻPDBsumƒf[ƒ^7xy7_lp$ b PDBsumƒf[ƒ^7xy6_lpiBAY 60-6583j$@mBAY 60-6583 - Wikipedian
8hdo‚ĚChain RiƒAƒfƒmƒVƒ“A2BŽó—e‘́GƒAƒSƒjƒXƒgBAY 60-6583Œ‹‡j@I5DiBAY 60-6583j‘I‘đ@“ŻPDBsumƒf[ƒ^8hdo_lp$

ƒAƒ~ƒmŽ_‚¨‚ć‚Ń“ÁŤŠî‚̐e…ŤE‘a…Ť b Log P‚đƒ|ƒPƒbƒg‚ɁI

ŽQlŽ‘—ż—áFNature ƒnƒCƒ‰ƒCƒgw\‘˘ś•¨ŠwF ƒ€ƒXƒJƒŠƒ“ŤƒAƒZƒ`ƒ‹ƒRƒŠƒ“Žó—e‘ĚM1‚¨‚ć‚ŃM4‚̍\‘˘xi2016/03/17j




Native phasing of x-ray free-electron laser data for a G protein-coupled receptoriScience AdvancesC2016/09/23j


œŽó—e‘ĚŠÖ˜A (2)

ƒAƒ~ƒmF@ChainF@CPKF@a@JmolF@RasmolF a ”ZÔ@—΁@”Zƒsƒ“ƒN@žň
Ž_ŤE’†ŤE‰–ŠîŤ‹ć•Ę@‹ÉŤE”ń‹ÉŤ‹ć•Ę@‘a…ŤƒCƒ“ƒfƒbƒNƒX‡@I/O’l‡i“ÁŤŠî Rj@“™“d“_‡@ƒRƒ“ƒzƒ[ƒVƒ‡ƒ“‘I‘𐍁iƒżƒwƒŠƒbƒNƒXEƒŔƒXƒgƒ‰ƒ“ƒhj
…‘fŒ‹‡•\ŽŚ b S-SŒ‹‡•\ŽŚ@ b @
b ”wŒiE•@ŠD@”’@Ž
@Chain‘I‘đF A B C D E F G H I J K L M N O P
7ym8‚ĚChain Aiƒż1AƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒż1AARjG‘I‘đ“IƒAƒSƒjƒXƒg ƒIƒLƒVƒƒ^ƒ]ƒŠƒ“qoxymetazolinerŒ‹‡CKobilka‚ç‚É‚ć‚éj@“ŻPDBsumƒf[ƒ^7ym8_J5C$ b PDBsumƒf[ƒ^7ymj_JGXiƒAƒ“ƒ^ƒSƒjƒXƒg ƒ^ƒ€ƒXƒƒVƒ“qtamsulosinrj$@mAlpha-1A adrenergic receptor - Wikipedian
7b6wiƒż1BƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒż1BARjGƒCƒ“ƒo[ƒXƒAƒSƒjƒXƒg(+)-cyclazosinŒ‹‡j@mAlpha-1B adrenergic receptor - Wikipedian
2ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒż2ARjGƒAƒ“ƒ^ƒSƒjƒXƒgRS 79948Œ‹‡j@“ŻPDBsumƒf[ƒ^6kux_E3F$ b PDBsumƒf[ƒ^6kuy_E39i•”•ŞƒAƒSƒjƒXƒgRESŒ‹‡j$@mAlpha-2 adrenergic receptor - Wikipedian
7eja‚ĚChain Riƒż2AƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒż2AARjGƒfƒNƒXƒƒfƒgƒ~ƒWƒ“Œ‹‡jj@“ŻPDBsumƒf[ƒ^7eja_lp$@mAlpha-2A adrenergic receptor - WikipediaCDexmedetomidine - Wikipedian
7w6p‚ĚChain Riƒż2AƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒż2AARjGƒAƒSƒjƒXƒg'9087Œ‹‡jj@“ŻPDBsumƒf[ƒ^7w6p_W96$
2vt4‚ĚChain A*iƒŔ1ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ1ARjGƒVƒAƒmƒsƒ“ƒhƒ[ƒ‹Œ‹‡j@P32iƒVƒAƒmƒsƒ“ƒhƒ[ƒ‹j‘I‘đ@mBeta-1 adrenergic receptor - Wikipedian
2y00‚ĚChain AiƒŔ1ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ1ARjG ƒhƒuƒ^ƒ~ƒ“Œ‹‡j@Y00iƒhƒuƒ^ƒ~ƒ“j‘I‘đ@“ŻPDBsumƒf[ƒ^2y00_Y00$
4gpo‚ĚChain AiƒŔ1ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ1ARjj
5f8u‚ĚChain AiƒŔ1ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ1ARjG4-{[(2S)-3-(tert-ƒuƒ`ƒ‹ƒAƒ~ƒm)-2-ƒqƒhƒƒLƒVƒvƒƒsƒ‹]ƒIƒLƒV}-3H-ƒCƒ“ƒh[ƒ‹-2-ƒJƒ‹ƒ{ƒjƒgƒŠƒ‹qƒVƒAƒmƒsƒ“ƒhƒ[ƒ‹rŒ‹‡j@P32iƒVƒAƒmƒsƒ“ƒhƒ[ƒ‹j‘I‘đ@“ŻPDBsumƒf[ƒ^5f8u_P32[Chain B]$
6h7n‚ĚChain AECEEiƒŔ1ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ1ARjGƒ`ƒIƒŒƒhƒLƒVƒ“1‚ƍR‘Ěƒtƒ‰ƒOƒƒ“ƒgNb6B9‚Ć‚Ě•Ą‡‘́CƒLƒTƒ‚ƒeƒ[ƒ‹Œ‹‡j@FVKiƒLƒTƒ‚ƒeƒ[ƒ‹j‘I‘đ b PDBsumƒf[ƒ^6h7j_5FWiƒCƒ\ƒvƒŒƒiƒŠƒ“Œ‹‡j$@PDBsumƒf[ƒ^6h7k_FVNiƒŠƒKƒ“ƒhFVNŒ‹‡j$@PDBsumƒf[ƒ^6h7l_Y00iƒhƒuƒ^ƒ~ƒ“Œ‹‡j$@PDBsumƒf[ƒ^6h7m_68HiƒTƒ‹ƒuƒ^ƒ‚[ƒ‹Œ‹‡j$@PDBsumƒf[ƒ^6h7n_FVKiƒLƒTƒ‚ƒeƒ[ƒ‹Œ‹‡j$@PDBsumƒf[ƒ^6h7o_P32iƒŠƒKƒ“ƒhP32Œ‹‡j$@PDBsumƒf[ƒ^6ibl_H98iƒzƒ‹ƒ‚ƒeƒ[ƒ‹qƒtƒHƒ‹ƒ‚ƒeƒ[ƒ‹rŒ‹‡j$@Śˆę•”ƒŠƒKƒ“ƒh‚́u‹T-C-C-Nv\‘˘‚đ—L‚ˇ‚é
6tko‚ĚChain AiƒŔ1ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ1ARjGƒzƒ‹ƒ‚ƒeƒ[ƒ‹qƒtƒHƒ‹ƒ‚ƒeƒ[ƒ‹rŒ‹‡j@“ŻPDBsumƒf[ƒ^6tko_H98$ b “ŻChain BiƒŔ-ƒAƒŒƒXƒ`ƒ“1C—Œ¤•ĘŒ¤‹†‚Ĺˆř—pj@I31, I168, I207, I214, I314‹óŠÔ[“UiI386‚Í–ł‚ľj^ƒż’Y‘fƒ‰ƒxƒ‹•\ŽŚ
7jjo‚ĚChain RiƒŔ1ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ1ARjGƒCƒ\ƒvƒƒeƒŒƒm[ƒ‹Œ‹‡j@“ŻPDBsumƒf[ƒ^7jjo_5FW$
7bu6‚ĚChain AiƒŔ1ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ1ARjGƒmƒ‹ƒAƒhƒŒƒiƒŠƒ“qƒmƒ‹ƒGƒsƒlƒtƒŠƒ“r‚Ćƒiƒmƒ{ƒfƒB6B9‚ŞŒ‹‡CKobilka‚ç‚É‚ć‚éj@E5Eiƒmƒ‹ƒAƒhƒŒƒiƒŠƒ“j‘I‘đ@“ŻPDBsumƒf[ƒ^7bu6_E5E$ b PDBsumƒf[ƒ^7bu7_P0GiBI-167107j$
7s0f‚ĚChain RiƒŔ1ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ1ARjGƒCƒ\ƒvƒƒeƒŒƒm[ƒ‹Œ‹‡j@“ŻPDBsumƒf[ƒ^7s0f_5FW$ b PDBsumƒf[ƒ^7s0g_5FW$
8dcs‚ĚChain RiƒŔ1ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ1ARjGƒVƒAƒmƒsƒ“ƒhƒ[ƒ‹Œ‹‡j@“ŻPDBsumƒf[ƒ^8dcs_P32$
2rh1*%iƒŔ2ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ2ARjGƒJƒ‰ƒ]ƒ[ƒ‹‚ŞŒ‹‡CKobilka‚ç‚É‚ć‚éj@CAUiƒJƒ‰ƒ]ƒ[ƒ‹j‘I‘đ@“ŻPDBsumƒf[ƒ^2rh1_CAU$@mBeta-2 adrenergic receptor - Wikipedian
5x7diƒŔ2ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ2ARjGƒJƒ‰ƒ]ƒ[ƒ‹‚Ů‚Š‚ŞŒ‹‡CKobilka‚ç‚É‚ć‚éj@8VSi4-carbamoyl-N-[(2R)-2-cyclohexyl-2-phenylacetyl]- L-phenylalanyl-3-bromo-N-methyl-L-phenylalaninamidej‘I‘đ@CAUiƒJƒ‰ƒ]ƒ[ƒ‹j‘I‘đ@“ŻPDBsumƒf[ƒ^5x7d_8VS$@“ŻPDBsumƒf[ƒ^5x7d_CAU$
6e67‚ĚChain AiƒŔ2ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ2ARjj@“ŻPDBsumƒf[ƒ^6e67_P0G$
6kr8‚ĚModel 1iƒŔ2ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ2ARjj@NPxxYƒ‚ƒ`[ƒti–{ƒf[ƒ^‚Ĺ‚ÍNPLIYj‘I‘đ
6n48iƒŔ2ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ2ARjGƒiƒmƒ{ƒfƒB6B9‚Ů‚Š‚ŞŒ‹‡CKobilka‚ç‚É‚ć‚éj@P0GiBI-167107j‘I‘đ@KBY‘I‘đ@Chain B‚đChainF‚Ɂ@“ŻPDBsumƒf[ƒ^6n48_P0G$
6ps3iƒŔ2ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ2ARjGƒJƒ‹ƒxƒWƒ[ƒ‹‚ŞŒ‹‡j@CVDiƒJƒ‹ƒxƒWƒ[ƒ‹j‘I‘đ@Chain B‚đChainF‚Ɂ@“ŻPDBsumƒf[ƒ^6ps3_CVD$
7dhi‚ĚChain RiƒŔ2ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ2ARjGƒTƒ‹ƒuƒ^ƒ‚[ƒ‹‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7dhi_68H$ b 7dhr_5FW$iƒCƒ\ƒvƒŒƒiƒŠƒ“qƒCƒ\ƒvƒƒeƒŒƒm[ƒ‹rŒ‹‡j
7xk9‚ĚChain AiƒŔ2ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ2ARjGconstrained isoproterenol‚ŞŒ‹‡CKobilka‚ç‚É‚ć‚éj@“ŻPDBsumƒf[ƒ^7xk9_lp$
6ni3iƒŔ2V2Žó—e‘́iƒŔ2ƒAƒhƒŒƒiƒŠƒ“Žó—e‘ĚƒLƒƒ‰-ƒAƒ‹ƒMƒjƒ“ƒoƒ\ƒvƒŒƒVƒ“Žó—e‘Ě2j-Gsƒ^ƒ“ƒpƒNŽż•Ą‡‘́Gƒiƒmƒ{ƒfƒB35‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^6ni3_P0G$@mVasopressin receptor 2 - Wikipedian
7dh5‚ĚChain RiƒŔ3ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ3ARjG‘I‘đ“IŽhŒƒ–ňƒ~ƒ‰ƒxƒOƒƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7dh5_H6U$@mBeta-3 adrenergic receptor - Wikipedian
7xji‚ĚChain RiƒŔ3ƒAƒhƒŒƒiƒŠƒ“Žó—e‘́iƒŔ3ARjG‘I‘đ“IƒAƒSƒjƒXƒg ƒ\ƒ‰ƒxƒOƒƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7xjiR_lp$@mSolabegron - Wikipedian
4zudiƒIƒ‹ƒƒTƒ‹ƒ^ƒ“‚ŞŒ‹‡‚ľ‚˝ƒAƒ“ƒWƒIƒeƒ“ƒVƒ“Žó—e‘Ě AT1Rj@“ŻPDBsumƒf[ƒ^4zud_OLM$@mAngiotensin receptor - WikipediaCOlmesartan - Wikipedian
6do1‚ĚChain AECEEEHiƒAƒ“ƒWƒIƒeƒ“ƒVƒ“Žó—e‘Ě AT1Rj@Chain HiƒAƒ“ƒWƒIƒeƒ“ƒVƒ“—lƒyƒvƒ`ƒhS1I8j‘I‘đ@“ŻPDBsumƒf[ƒ^6do1_SAR1~ILE8iChain BEDEFEGƒOƒ‹[ƒv‚ć‚čj$@Chain GiƒAƒ“ƒWƒIƒeƒ“ƒVƒ“—lƒyƒvƒ`ƒhS1I8j‘I‘đ
6os2‚ĚChain AEBiƒAƒ“ƒWƒIƒeƒ“ƒVƒ“Žó—e‘Ě AT1RGƒiƒmƒ{ƒfƒBœ‚­j@Chain BiTRV026j‘I‘đ
5unf‚ĚChain AiƒAƒ“ƒWƒIƒeƒ“ƒVƒ“Žó—e‘Ě AT2Rj@“ŻPDBsumƒf[ƒ^5unf_8ES$
5ungiƒAƒ“ƒWƒIƒeƒ“ƒVƒ“Žó—e‘Ě AT2Rj@8ES‘I‘đ@“ŻPDBsumƒf[ƒ^5ung_8ES$
5unh‚ĚChain AiƒAƒ“ƒWƒIƒeƒ“ƒVƒ“Žó—e‘Ě AT2Rj@“ŻPDBsumƒf[ƒ^5unh_8EM$
5xjmiƒAƒ“ƒWƒIƒeƒ“ƒVƒ“Žó—e‘Ě AT2Rj@Chain BiƒAƒ“ƒWƒIƒeƒ“ƒVƒ“GSAR-ARG-VAL-TYR-ILE-HIS-PRO-ILEj‘I‘đ@“ŻPDBsumƒf[ƒ^5xjm_SAR~ILE$
5xjmiƒAƒ“ƒWƒIƒeƒ“ƒVƒ“Žó—e‘Ě AT2Rj@Chain BiƒAƒ“ƒWƒIƒeƒ“ƒVƒ“GSAR-ARG-VAL-TYR-ILE-HIS-PRO-ILEj‘I‘đ@“ŻPDBsumƒf[ƒ^5xjm_SAR~ILE$
6jod‚ĚChain AiƒAƒ“ƒWƒIƒeƒ“ƒVƒ“Žó—e‘Ě AT2Rj
7jni‚ĚChain AiEMA401‚ŞŒ‹‡‚ľ‚˝ƒAƒ“ƒWƒIƒeƒ“ƒVƒ“Žó—e‘Ě AT2Rj@VFDiEMA401j‘I‘đ@“ŻPDBsumƒf[ƒ^7jni_VFD$@mEMA401 - Wikipedian
5glhiƒGƒ“ƒhƒZƒŠƒ“BŽó—e‘́GƒGƒ“ƒhƒZƒŠƒ“-1‚ŞŒ‹‡j@Chain BiƒGƒ“ƒhƒZƒŠƒ“-1j‘I‘đ b 5gliiƒGƒ“ƒhƒZƒŠƒ“BŽó—e‘̂̂݁j@¨ JmolƒgƒsƒbƒN@mEndothelin B receptor - WikipediaCEndothelin receptor - Wikipedian
5xpriƒGƒ“ƒhƒZƒŠƒ“BŽó—e‘́j@K86ibosentanj‘I‘đ@mBosentan - Wikipedian
6igliƒGƒ“ƒhƒZƒŠƒ“BŽó—e‘́GƒGƒ“ƒhƒZƒŠƒ“—ŢŽ—IRL1620qChain BrŒ‹‡j@Chain BiIRL1620j‘I‘đ
6tpkiƒIƒLƒVƒgƒVƒ“Žó—e‘́j@NU2iƒŒƒgƒVƒoƒ“j‘I‘đ@“ŻPDBsumƒf[ƒ^6tpk_NU2$@mOxytocin receptor - WikipediaCRetosiban - Wikipedian
7ryc‚ĚChain LEOiƒIƒLƒVƒgƒVƒ“Žó—e‘́GƒIƒLƒVƒgƒVƒ“-NH2‚ŞŒ‹‡j@Chain LiƒIƒLƒVƒgƒVƒ“-NH2j‘I‘đ@“ŻPDBsumƒf[ƒ^7ryc_CYS-TYR-ILE-GLN-ASN-CYS-PRO-LEU-GLY-NH2$@mOxytocin - Wikipedian
4ej4iƒÂƒIƒsƒIƒCƒhŽó—e‘́j@EJ4iƒiƒ‹ƒgƒŠƒ“ƒh[ƒ‹j‘I‘đ@“ŻPDBsumƒf[ƒ^4ej4_EJ4$@mƒÂ-opioid receptor - Wikipedian
4djh*%iƒČƒIƒsƒIƒCƒhŽó—e‘́qKORrGƒAƒSƒjƒXƒgJDTic‚ŞŒ‹‡j@JDCiJDTicj‘I‘đ@“ŻPDBsumƒf[ƒ^4djh_JDC$@mƒČ-opioid receptor - Wikipedian
6b73‚ĚChain AEDiƒČƒIƒsƒIƒCƒhŽó—e‘́GƒAƒSƒjƒXƒgMP1104‚Ćƒiƒmƒ{ƒfƒB‚ŞŒ‹‡j@CVViMP1104j‘I‘đ@“ŻPDBsumƒf[ƒ^6b73_CVV$
6vi4‚ĚChain AiƒČƒIƒsƒIƒCƒhŽó—e‘́GƒAƒSƒjƒXƒgJDTic‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^6vi4_JDC$
7yit‚ĚChain AiƒČƒIƒsƒIƒCƒhŽó—e‘́GƒAƒSƒjƒXƒg‚Ěƒiƒ‹ƒtƒ‰ƒtƒBƒ“qnalfurafiner‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7yit_IVB$ b ƒiƒ‹ƒtƒ‰ƒtƒBƒ“inalfurafinej @¨ JmolƒgƒsƒbƒN
8dzr‚ĚChain AEBiƒČƒIƒsƒIƒCƒhŽó—e‘́GChain B‚ÍGƒ^ƒ“ƒpƒNŽżgustducinj@Chain B‚đChainF‚Ɂ@“ŻPDBsumƒf[ƒ^8dzr_lp$
8feg‚ĚChain AEBiƒČƒIƒsƒIƒCƒhŽó—e‘́GƒAƒSƒjƒXƒgMP1104‚Ě—U“ą‘Ě‚ŞŒ‹‡j@Chain A‘I‘đ@DPN{XT9‘I‘đ@“ŻPDBsumƒf[ƒ^8feg_lp$
4dkl*iƒĘƒIƒsƒIƒCƒhŽó—e‘́Gƒ‚ƒ‹ƒtƒBƒiƒ“ŒnƒAƒ“ƒ^ƒSƒjƒXƒg‚ŞŒ‹‡j@BF0iƒAƒ“ƒ^ƒSƒjƒXƒgj‘I‘đ@“ŻPDBsumƒf[ƒ^4dkl_BF0$@mƒĘ-opioid receptor - Wikipedian
5c1miƒĘƒIƒsƒIƒCƒhŽó—e‘́j@“ŻPDBsumƒf[ƒ^5c1m_4VO$@4VOiƒAƒSƒjƒXƒgBU72j‘I‘đ@¨ JmolƒgƒsƒbƒN
6ddfiGiƒ^ƒ“ƒpƒNŽż‚ĆƒAƒSƒjƒXƒgDAMGO‚ŞŒ‹‡‚ľ‚˝ƒĘƒIƒsƒIƒCƒhŽó—e‘́j@Chain DiƒAƒSƒjƒXƒgDAMGOj‘I‘đ@“ŻPDBsumƒf[ƒ^6ddf_DAMGO$@mDAMGO - Wikipedian
7sbf‚ĚChain RiƒIƒsƒIƒCƒh’Á’É–ňPZM21‚ŞŒ‹‡‚ľ‚˝ƒĘƒIƒsƒIƒCƒhŽó—e‘́G2012”Nƒm[ƒxƒ‹‰ťŠwÜŽóÜ‚ĚKobilka‚ç‚É‚ć‚éj@“ŻPDBsumƒf[ƒ^7sbfR_lp$@mPZM21 - Wikipedian
7u2l‚ĚChain DiƒĘƒIƒsƒIƒCƒhŽó—e‘́G2012”Nƒm[ƒxƒ‹‰ťŠwÜŽóÜ‚ĚKobilka‚ç‚É‚ć‚éj@“ŻPDBsumƒf[ƒ^7u2lD_lp$
8efl‚ĚChain RiƒAƒSƒjƒXƒgSR17018‚ŞŒ‹‡‚ľ‚˝ƒĘƒIƒsƒIƒCƒhŽó—e‘́j@WH9iSR17018j‘I‘đ@“ŻPDBsumƒf[ƒ^ 8eflR_lp$ b PDBsumƒf[ƒ^ 8ef5R_lp$iƒtƒFƒ“ƒ^ƒjƒ‹j@PDBsumƒf[ƒ^ 8ef6R_lp$iƒ‚ƒ‹ƒqƒl^ƒ‚ƒ‹ƒtƒBƒ“j@¨ ŠëŒŻƒhƒ‰ƒbƒO
7t2h‚ĚChain DiƒƒtƒFƒ“ƒ^ƒjƒ‹qlofentanilr‚ŞŒ‹‡‚ľ‚˝ƒĘƒIƒsƒIƒCƒhŽó—e‘́GKobilka‚ç‚É‚ć‚éj@“ŻPDBsumƒf[ƒ^7t2hD_lp$@mLofentanil - Wikipedian
7u2k‚ĚChain DiƒĘƒIƒsƒIƒCƒhŽó—e‘́j@“ŻPDBsumƒf[ƒ^7u2kD_lp$
8e0g‚ĚChain AiƒIƒsƒIƒCƒh‚ĹBU72‚ŞŒ‹‡‚ľ‚˝ƒĘƒIƒsƒIƒCƒhŽó—e‘́j@VF1iBU72j‘I‘đ@“ŻPDBsumƒf[ƒ^8e0g_lp$@mBU72 - Wikipedian
4ea3*%iƒmƒVƒZƒvƒ`ƒ“/ƒIƒ‹ƒtƒ@ƒjƒ“FQiN/OFQjŽó—e‘́j@0NN‘I‘đ@PDBsumƒf[ƒ^i0NNCA˝j$@mNociceptin receptor - Wikipedian
6to7‚ĚChain AiƒIƒŒƒLƒVƒ“1qOX1rŽó—e‘́GƒXƒ{ƒŒƒLƒTƒ“ƒg‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^6to7_SUV$ a 6tpj‚ĚChain AiƒIƒŒƒLƒVƒ“2qOX2rŽó—e‘́GƒXƒ{ƒŒƒLƒTƒ“ƒg‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^6tpj_SUViƒXƒ{ƒŒƒLƒTƒ“ƒg‚ĚHŒ´Žq•t‰Áj$
6tot‚ĚChain AiƒIƒŒƒLƒVƒ“1qOX1rŽó—e‘́GƒŒƒ“ƒ{ƒŒƒLƒTƒ“ƒg‚ŞŒ‹‡j@NRKiƒŒƒ“ƒ{ƒŒƒLƒTƒ“ƒgj‘I‘đ@“ŻPDBsumƒf[ƒ^6tot_NRK[401(A)]$@mLemborexant - Wikipedian
4rnbiƒIƒŒƒLƒVƒ“2qOX2rŽó—e‘́GƒXƒ{ƒŒƒLƒTƒ“ƒg‚ŞŒ‹‡CŒťÝ4s0v‚É’uŠˇj@SUViƒXƒ{ƒŒƒLƒTƒ“ƒgj‘I‘đ@“ŻPDBsumƒf[ƒ^4rnb_SUV$@¨ JmolƒgƒsƒbƒN b ƒXƒ{ƒŒƒLƒTƒ“ƒgisuvorexantj
7l1v‚ĚChain RiƒIƒŒƒLƒVƒ“2qOX2rŽó—e‘́GƒAƒSƒjƒXƒg‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7l1v_XGD$
7sqo‚ĚChain RiƒIƒŒƒLƒVƒ“2qOX2rŽó—e‘́GƒAƒSƒjƒXƒgTAK-925‚ŞŒ‹‡j@A6FiTAK-925j‘I‘đ@“ŻPDBsumƒf[ƒ^7sqoR_lp$ b 7sr8‚ĚChain Ri“ŻGTAK-925‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7sr8R_lp$
ŸƒJƒ‹ƒVƒEƒ€Š´’mŽó—e‘ĚŠÖ˜A@mCalcium-sensing receptor - Wikipedian
7dd7iƒGƒ{ƒJƒ‹ƒZƒg‚ŞŒ‹‡‚ľ‚˝ƒJƒ‹ƒVƒEƒ€Š´’mŽó—e‘́j@H43iƒGƒ{ƒJƒ‹ƒZƒgj‘I‘đ@“ŻPDBsumƒf[ƒ^7dd7_H43$ b PDBsumƒf[ƒ^7dd5_YP1iNPS-2143j$@mNPS-2143 - Wikipedian
7sin‚ĚChain AiƒlƒKƒeƒBƒuƒAƒƒXƒeƒŠƒbƒN’˛ßˆöŽqNPS-2143‚ŞŒ‹‡‚ľ‚˝ƒJƒ‹ƒVƒEƒ€Š´’mŽó—e‘́j@“ŻPDBsumƒf[ƒ^7sin_YP1$ b PDBsumƒf[ƒ^7sil_9IGiƒ|ƒWƒeƒBƒuƒAƒƒXƒeƒŠƒbƒN’˛ßˆöŽqj$
7e6t‚ĚChain AiTNCA‚ŞŒ‹‡‚ľ‚˝ƒqƒgƒJƒ‹ƒVƒEƒ€Š´’mŽó—e‘́j@TCRiTNCAj‘I‘đ
8szh‚ĚChain AiƒVƒiƒJƒ‹ƒZƒgqcinacalcetr‚ŞŒ‹‡‚ľ‚˝ƒJƒ‹ƒVƒEƒ€Š´’mŽó—e‘́j@“ŻPDBsumƒf[ƒ^8szh_YP4$@mCinacalcet - Wikipedian
ŸGABABŽó—e‘ĚŠÖ˜A@mGABAB receptor - Wikipedian
6wiv‚ĚChain AiGABABŽó—e‘́G“ŕˆöŤƒŠƒ“Ž‰Žż‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^6wiv_U3G$@“ŻPDBsumƒf[ƒ^6wiv_U3D[Chain B]$
6w2y‚ĚChain Ai‘ăŽÓŒ^GABABŽó—e‘́GƒŠƒ“Ž‰Žż‚ĆƒAƒ“ƒ^ƒSƒjƒXƒgCGP55845‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^6w2y_L9QiƒŠƒ“Ž‰Žżj$@“ŻPDBsumƒf[ƒ^6w2y_SGGiCGP55845j$
7cum‚ĚChain AiGABABŽó—e‘́GƒAƒ“ƒ^ƒSƒjƒXƒgCGP54626‚ŞŒ‹‡j@2BViCGP54626j‘I‘đ@“ŻPDBsumƒf[ƒ^7cum_2BV[Chain B]$
7eb2‚ĚChain CEDiGABABŽó—e‘́GƒAƒSƒjƒXƒg‚ĚƒoƒNƒƒtƒFƒ“qbaclofenr‚Ćƒ|ƒWƒeƒBƒuƒAƒƒXƒeƒŠƒbƒN’˛ßˆöŽq‚ĚBHFF‚ŞŒ‹‡j@2C0iƒoƒNƒƒtƒFƒ“j‘I‘đ@FN0iBHFFj‘I‘đ@“ŻPDBsumƒf[ƒ^7eb2_2C0$@“ŻPDBsumƒf[ƒ^7eb2_FN0$@mBaclofen - WikipediaCBHFF - WikipediaCAllosteric modulator - Wikipedian
8ww2‚ĚChain RiGPR3GƒIƒŒƒCƒ“Ž_‚ŞŒ‹‡j@OLAiƒIƒŒƒCƒ“Ž_j‘I‘đ@“ŻPDBsumƒf[ƒ^8ww2_lp$@mGPR3 - Wikipedian
8sai‚ĚChain AiGPR34GLysoPS (18:1)‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8sai_S12$@mGPR34 - Wikipedian
8k4n‚ĚChain DiGPR34j@“ŻPDBsumƒf[ƒ^8k4n_lp$
8wrb‚ĚChain RiGPR34GƒŠƒ]ƒzƒXƒtƒ@ƒ`ƒWƒ‹ƒZƒŠƒ“qlysophosphatidylseriner‚ŞŒ‹‡j@UBL‘I‘đ@“ŻPDBsumƒf[ƒ^8wrb_lpiUBL-Ser502j$
8h8j‚ĚChain CiƒNƒ‰ƒXAƒI[ƒtƒ@ƒ“Žó—e‘ĚGPR35GƒAƒSƒjƒXƒglodoxamide‚ŞŒ‹‡j@WYBiƒƒhƒLƒTƒ~ƒhj‘I‘đ@“ŻPDBsumƒf[ƒ^8h8jC_lp$@mGPR35 - WikipediaCOrphan receptor - Wikipedian
4phuiƒqƒgGPR40qFFAR1rGƒAƒSƒjƒXƒgTAK-875‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^4phu_2YBiTAK-875j$@2YBiTAK-875j‘I‘đ@mFree fatty acid receptor 1 - Wikipedian
8eit‚ĚChain RiFFAR1GDHA‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8eit_lpiDHAj$ b PDBsumƒf[ƒ^8ejc_lpiTAK-875j$
6li0iƒNƒ‰ƒXAƒI[ƒtƒ@ƒ“Žó—e‘ĚGPR52j@EN6iƒAƒSƒjƒXƒgc17j‘I‘đ@“ŻPDBsumƒf[ƒ^6li0_EN6$@mGPR52 - Wikipedian
8hmp‚ĚChain RiƒNƒ‰ƒXAƒI[ƒtƒ@ƒ“Žó—e‘ĚGPR52j@EN6iƒAƒSƒjƒXƒgc17j‘I‘đ@“ŻPDBsumƒf[ƒ^8hmp_lp$
8tb7‚ĚChain RiGPR61Gcompound 1‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8tb7_ZOB$@mGPR61 - Wikipedian
8g05‚ĚChain RiGPR84GƒAƒSƒjƒXƒg‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8g05_lp$@mGPR84 - Wikipedian
8j19‚ĚChain RiƒNƒ‰ƒXA GPCRCGPR84GLY237‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8j19_lp$
7yk7‚ĚChain RiGPR100GƒAƒSƒjƒXƒgDC591053‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7yk7_IYM$@mRelaxin/insulin-like family peptide receptor 4 - Wikipedian
7xk2‚ĚChain RiGPR109AqƒqƒhƒƒLƒVƒJƒ‹ƒ{ƒ“Ž_Žó—e‘Ě2CHCA2CHCAR2rGƒAƒSƒjƒXƒgMK-6892‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7xk2R_lp$@mHydroxycarboxylic acid receptor 2 - Wikipedian
8jii‚ĚChain AiGPR109AqƒqƒhƒƒLƒVƒJƒ‹ƒ{ƒ“Ž_Žó—e‘Ě2CHCAR2rGcompound 9n‚ŞŒ‹‡j@IX8‘I‘đ@“ŻPDBsumƒf[ƒ^8jii_IX8$
8ihf‚ĚChain RiGPR109AGƒAƒSƒjƒXƒgMK-6892‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8ihf_FI7$
8ijd‚ĚChain AiGPR109AqƒqƒhƒƒLƒVƒJƒ‹ƒ{ƒ“Ž_Žó—e‘Ě2CHCAR2rGƒAƒSƒjƒXƒgMK-6892‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8ijd_lp$
8jz7‚ĚChain AiGPR109AqƒqƒhƒƒLƒVƒJƒ‹ƒ{ƒ“Ž_Žó—e‘Ě2CHCAR2rGƒAƒSƒjƒXƒgMK-6892‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8jz7_FI7$
8i7w‚ĚChain AiGPR109AqƒqƒhƒƒLƒVƒJƒ‹ƒ{ƒ“Ž_Žó—e‘Ě2CHCAR2rGƒAƒSƒjƒXƒgGSK256073‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8i7w_lp$
8j6p‚ĚChain RiGPR109AqƒqƒhƒƒLƒVƒJƒ‹ƒ{ƒ“Ž_Žó—e‘Ě2CHCAR2rGƒAƒSƒjƒXƒgcompound 9n‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8j6p_lp$ b PDBsumƒf[ƒ^8j6r_lpiƒAƒSƒjƒXƒgMK-6892j$
7wcn‚ĚChain RiGPR119GƒAƒSƒjƒXƒgAR231453‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7wcn_lpiAR231453j$@mGPR119 - Wikipedian
8g59‚ĚChain RiGPR120GƒAƒSƒjƒXƒgTUG-891‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8g59_lpiTUG-891j$@mGPR120 - Wikipedian
8id8‚ĚChain RiGPR120GƒAƒSƒjƒXƒgTUG-891‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8id8_lpiTUG-891j$ b PDBsumƒf[ƒ^8id9_lpiEPAj$
8hvi‚ĚChain RiGPR132GNOX-6-7‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8hvi_NFI$@mGPR132 - Wikipedian
7vuh‚ĚChain RiƒNƒ‰ƒXAƒI[ƒtƒ@ƒ“Žó—e‘ĚGPR139GJNJ-63533054‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7vuh_7ZQ$@mGPR139 - Wikipedian
7xv3‚ĚChain RiƒNƒ‰ƒXAƒI[ƒtƒ@ƒ“Žó—e‘ĚGPR174Gligand WJS‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7xv3_lp$@mGPR174 - Wikipedian
8kh5‚ĚChain AiGPR174GlysoPS‚ŞŒ‹‡j@LPSilysoPSj‘I‘đ@“ŻPDBsumƒf[ƒ^8kh5_lp$
8izb‚ĚChain RiGPR174GƒŠƒ]ƒzƒXƒtƒ@ƒ`ƒWƒ‹ƒZƒŠƒ“qlysophosphatidylseriner‚ŞŒ‹‡j@UBL‘I‘đ@“ŻPDBsumƒf[ƒ^8izb_lpiUBL-Ser502j$
7tuy‚ĚChain RiEBI2/GPR183GGSK682753A‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7tuyR_lp$@mGPR183 - Wikipedian

ŽQlŽ‘—ż—áFƒuƒ‰ƒCƒAƒ“EƒRƒrƒ‹ƒJ Brian K. KobilkaiChem-StationC2012/10/11j

ƒIƒsƒIƒCƒhŽó—e‘Ě‚ĚŽĺ—v‚ČƒNƒ‰ƒX—áƒĘ 4dklCƒČ 4djhCƒÂ 4ej4C‚¨‚ć‚ŃŠÖ˜A‚ˇ‚éƒmƒVƒZƒvƒ`ƒ“ƒIƒsƒIƒCƒhŽó—e‘́iNOPj 4ea3
ŽQlFĄŒŽ‚Ě•ŞŽq 217: ƒIƒsƒIƒCƒhŽó—e‘́iOpioid ReceptorsjiPDBjC2018/01j@¨ JmolƒgƒsƒbƒN[1]b[2]

œŽó—e‘ĚŠÖ˜A (3)

ƒAƒ~ƒmF@ChainF@CPKF@a@JmolF@RasmolF a ”ZÔ@—΁@”Zƒsƒ“ƒN@žň
Ž_ŤE’†ŤE‰–ŠîŤ‹ć•Ę@‹ÉŤE”ń‹ÉŤ‹ć•Ę@‘a…ŤƒCƒ“ƒfƒbƒNƒX‡@I/O’l‡i“ÁŤŠî Rj@“™“d“_‡@ƒRƒ“ƒzƒ[ƒVƒ‡ƒ“‘I‘𐍁iƒżƒwƒŠƒbƒNƒXEƒŔƒXƒgƒ‰ƒ“ƒhj
…‘fŒ‹‡•\ŽŚ b S-SŒ‹‡•\ŽŚ@ b @
b ”wŒiE•@ŠD@”’@Ž
@Chain‘I‘đF A B C D E F G H I J K L M N O P
5tgziƒJƒ“ƒiƒrƒmƒCƒhŽó—e‘ĚCB1j@ZDGiAM6538j‘I‘đ@“ŻPDBsumƒf[ƒ^5tgz_ZDG$@¨ JmolƒgƒsƒbƒN@mCannabinoid receptor - Wikipedian
5u09iƒJƒ“ƒiƒrƒmƒCƒhŽó—e‘ĚCB1j@7DYitaranabantj‘I‘đ@“ŻPDBsumƒf[ƒ^5u09_7DY$@¨ Nature ƒnƒCƒ‰ƒCƒgi2016/12/21j
6n4biƒJƒ“ƒiƒrƒmƒCƒhŽó—e‘ĚCB1GGƒ^ƒ“ƒpƒNŽż‚ĆƒAƒSƒjƒXƒgMDMB-Fubinaca‚ŞŒ‹‡j@KCAiƒAƒSƒjƒXƒgMDMB-Fubinacaj‘I‘đ@“ŻPDBsumƒf[ƒ^6n4b_KCA$@mMDMB-FUBINACA - Wikipedian
6kqiiƒJƒ“ƒiƒrƒmƒCƒhŽó—e‘ĚCB1GƒAƒƒXƒeƒŠƒbƒN’˛ßˆöŽq‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^6kqi_9GF$@mCP 55,940 - Wikipedian
7wv9‚ĚChain RiƒJƒ“ƒiƒrƒmƒCƒhŽó—e‘ĚCB1G“ŻăCP55940‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7wv9R_lp$
8ghv‚ĚChain DiƒJƒ“ƒiƒrƒmƒCƒhŽó—e‘ĚCB1GAM8125‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8ghv_lp$
8k8j‚ĚChain RiƒJƒ“ƒiƒrƒmƒCƒhŽó—e‘ĚCB1GƒtƒFƒmƒtƒBƒuƒ‰[ƒgqfenofibrater‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8k8j_lp$
8wrz‚ĚChain RiƒJƒ“ƒiƒrƒmƒCƒhŽó—e‘ĚCB1GƒAƒSƒjƒXƒgAM841‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8wrz_lp$
6kpciƒJƒ“ƒiƒrƒmƒCƒhŽó—e‘ĚCB2GƒAƒSƒjƒXƒgAM841‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^6kpc_8D0$ b PDBsumƒf[ƒ^6kpf_8D0iCB2j$@PDBsumƒf[ƒ^6kpg_8D0iCB1j$
6pt0‚ĚChain RiƒJƒ“ƒiƒrƒmƒCƒhŽó—e‘ĚCB2GƒAƒSƒjƒXƒgWIN 55,212-2‚ŞŒ‹‡j@WI5iƒAƒSƒjƒXƒgWIN 55,212-2j‘I‘đ@“ŻPDBsumƒf[ƒ^6pt0_WI5$@¨ JmolƒgƒsƒbƒNi“ŻƒŠƒKƒ“ƒhŒ‹‡j
8gut‚ĚChain RiƒJƒ“ƒiƒrƒmƒCƒhŽó—e‘ĚCB2G‘I‘đ“IƒAƒSƒjƒXƒgLEI-102‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8gut_KO8$
ŸškŠoŽó—e‘ĚŠÖ˜A@¨ ‘ź‚É”÷—ĘƒAƒ~ƒ“ŠÖ˜AŽó—e‘Ě9ŽQĆ
8f76‚ĚChain AiškŠoŽó—e‘́Gƒvƒƒpƒ“Ž_‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8f76_PPI$@mOlfactory receptor - WikipediaCOR51E2 - Wikipedian@¨ ĄŒŽ‚Ě•ŞŽq No.282 - škŠoŽó—e‘́iPDBjC2023/06j
8hti‚ĚChain RiškŠoŽó—e‘ĚOR52csCƒIƒNƒ^ƒ“Ž_‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8hti_lp$
4j4q#iƒIƒvƒVƒ“GškŠoŽó—e‘Ě‚Ěƒzƒ‚ƒƒW[ƒ‚ƒfƒŠƒ“ƒOCƒIƒNƒ`ƒ‹-ƒŔ-D-ƒOƒ‹ƒRƒVƒh‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^4j4q_BOG405$@BOG_405A‘I‘đ@mOlfactory receptor - Wikipedian
4l6riƒOƒ‹ƒJƒSƒ“Žó—e‘́j@mGlucagon receptor - Wikipedian
5xez‚ĚChain AiƒOƒ‹ƒJƒSƒ“Žó—e‘́GNNC0640‚ŞŒ‹‡j@97ViNNC0640j‘I‘đ@“ŻPDBsumƒf[ƒ^5xez_97V[1208(A)]$@“ŻPDBsumƒf[ƒ^5xez_97V[1207(B)]$
5xf1‚ĚChain AiƒOƒ‹ƒJƒSƒ“Žó—e‘́GNNC0640‚ŞŒ‹‡j@97ViNNC0640j‘I‘đ@“ŻPDBsumƒf[ƒ^5xf1_97V[1207(A)]$@“ŻPDBsumƒf[ƒ^5xf1_97V[1209(B)]$
5yqziƒOƒ‹ƒJƒSƒ“Žó—e‘́GƒOƒ‹ƒJƒSƒ“—ŢŽ—‘ĚNNC1702‚ŞŒ‹‡j@Chain PiNNC1702j‘I‘đ
6wpw‚ĚChain PERiƒOƒ‹ƒJƒSƒ“Žó—e‘́GƒOƒ‹ƒJƒSƒ“—U“ą‘ĚZP3780‚ŞŒ‹‡CKobilka‚ç‚É‚ć‚éj@Chain PiZP3780j‘I‘đ
5nx2iƒyƒvƒ`ƒhƒAƒSƒjƒXƒg‚ŞŒ‹‡‚ľ‚˝GLP-1qƒOƒ‹ƒJƒSƒ“—lƒyƒvƒ`ƒh-1rŽó—e‘́j@Chain Bitruncated peptide agonistGƒŠƒKƒ“ƒhŠÜ‚ށj‘I‘đ@“ŻPDBsumƒf[ƒ^5nx2_9DK~9DZi5nx2_9DK-9DQ-GLY-THR-9DT-THR-SER-ASP-9DW-9DZGChain Bj$@“ŻƒŠƒKƒ“ƒh‘I‘đ@mGlucagon-like peptide 1 receptor - Wikipedian
5vaiiGLP-1‚ĆGƒ^ƒ“ƒpƒNŽż‚ŞŒ‹‡‚ľ‚˝GLP-1Žó—e‘́CKobilka‚ç‚É‚ć‚éj@Chain R ‘I‘đ
5vew‚ĚChain AiGLP-1Žó—e‘́Gnegative allosteric modulator‚ĚPF-06372222‚ŞŒ‹‡j@97YiPF-06372222j‘I‘đ@“ŻPDBsumƒf[ƒ^5vew_97Y$
5vex‚ĚChain AiGLP-1Žó—e‘́Gnegative allosteric modulator‚ĚNNC0640‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^5vex_97V$
6b3jiGƒ^ƒ“ƒpƒNŽż‚Ćƒyƒvƒ`ƒhexendin-P5‚ŞŒ‹‡‚ľ‚˝GLP-1Žó—e‘́j@Chain RiGLP-1Žó—e‘́j‘I‘đ
6orv‚ĚChain PERiTT-OAD2‚ŞŒ‹‡‚ľ‚˝GLP-1Žó—e‘́GGƒ^ƒ“ƒpƒNŽż‚͏œ‚­j
6vcb‚ĚChain PERiGLP-1‚Ɓg•ŞŽqŒĐhLSN3160440‚ŞŒ‹‡‚ľ‚˝GLP-1Žó—e‘́CKobilka‚ç‚É‚ć‚éj@Chain PiGLP-1j‘I‘đ@“ŻPDBsumƒf[ƒ^6vcb_QW7$
6x1a‚ĚChain RiƒAƒSƒjƒXƒgPF-06882961‚ŞŒ‹‡‚ľ‚˝GLP-1Žó—e‘́j@“ŻPDBsumƒf[ƒ^6x1a_UK4$ a PDBsumƒf[ƒ^6x19_UK1iƒAƒSƒjƒXƒgCHU-128Œ‹‡j$
7c2e‚ĚChain RiƒAƒSƒjƒXƒgRGT1383‚ŞŒ‹‡‚ľ‚˝GLP-1Žó—e‘́j@“ŻPDBsumƒf[ƒ^7c2e_FFR$
7lci‚ĚChain RiPF-06882961‚ŞŒ‹‡‚ľ‚˝GLP-1Žó—e‘́j@“ŻPDBsumƒf[ƒ^7lci_UK4$ a PDBsumƒf[ƒ^7lcj_UK4$@PDBsumƒf[ƒ^7lck_UK4$
7e14‚ĚChain Riě“Ž–ňOWL833‚ŞŒ‹‡‚ľ‚˝GLP-1Žó—e‘́j@V6GiOWL833j‘I‘đ@“ŻPDBsumƒf[ƒ^7e14_V6G$
7rgp‚ĚChain PERiƒZƒ}ƒOƒ‹ƒ`ƒh‚ŞŒ‹‡‚ľ‚˝GLP-1Žó—e‘́j@Chain Pisemaglutidej‘I‘đ@“ŻChain PiƒAƒ~ƒmŽ_ŽcŠî 7-36j b 7ki0‚ĚChain PiƒAƒ~ƒmŽ_ŽcŠî 7-36j@mTirzepatide - WikipedianiƒZƒ}ƒOƒ‹ƒ`ƒh‚Í31ƒAƒ~ƒmŽ_ŽcŠî‚Ěƒyƒvƒ`ƒhF”z—ń HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG@c HisAlaGluGlyThrPheThrSerAspValSerSerTyrLeuGluGlyGlnAlaAlaLeuGluPheIleAlaTrpLeuValArgGlyArgGly@¨ DRUG: ƒZƒ}ƒOƒ‹ƒ`ƒh - KEGG b JmolƒgƒsƒbƒN
7rgp‚ĚChain PERiƒ`ƒ‹ƒ[ƒpƒ`ƒh‚ŞŒ‹‡‚ľ‚˝GLP-1Žó—e‘́CKobilka‚ç‚É‚ć‚éj@Chain Pitirzepatidej‘I‘đ@“ŻChain PiƒAƒ~ƒmŽ_ŽcŠî 1-31j b 7rbt‚ĚChain PiƒAƒ~ƒmŽ_ŽcŠî 1-32j@mTirzepatide - Wikipedianiƒ`ƒ‹ƒ[ƒpƒ`ƒh‚Í39ƒAƒ~ƒmŽ_ŽcŠî‚Ěƒyƒvƒ`ƒhF”z—ń YXEGTFTSDY SIXLDKIAQK AFVQWLIAGG PSSGAPPPSFTyr X GluGlyThrPheThrSerAspTyrSerIle X LeuAspLysIleAlaGlnLysAlaPheValGlnTrpLeuIleAlaGlyGlyProSerSerGlyAlaProProProSer@¨ KEGG DRUG: ƒ`ƒ‹ƒ[ƒpƒ`ƒhj
7x8s‚ĚChain RiƒAƒSƒjƒXƒgWB4-24‚ŞŒ‹‡‚ľ‚˝GLP-1Žó—e‘́j@“ŻPDBsumƒf[ƒ^7x8sR_lp$ b PDBsumƒf[ƒ^7x8rR_lpiƒAƒSƒjƒXƒgBoc5j$
7d68‚ĚChain PERiGLP-2‚ŞŒ‹‡‚ľ‚˝GLP-2Žó—e‘́qGLP-2Rrj
4or2i‘ăŽÓŒ^ƒOƒ‹ƒ^ƒ~ƒ“Ž_Žó—e‘Ě1j@FM9‘I‘đ@“ŻPDBsumƒf[ƒ^4or2_FM9$@¨ JmolƒgƒsƒbƒN@mMetabotropic glutamate receptorCClass C GPCR - WikipediaCMetabotropic glutamate receptor 1 - Wikipedian
7dge‚ĚChain Ai‘ăŽÓŒ^ƒOƒ‹ƒ^ƒ~ƒ“Ž_Žó—e‘Ě1qmGlu1rGL-ƒLƒXƒJƒ‹Ž_‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7dge_QUS$
7e9g‚ĚChain RESi‘ăŽÓŒ^ƒOƒ‹ƒ^ƒ~ƒ“Ž_Žó—e‘Ě2qmGlu2rGLY354740qƒGƒOƒ‹ƒƒKƒhCeglumegadr‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7e9g_40F$@mMetabotropic glutamate receptor 2 - Wikipedian
7epb‚ĚChain AEBi‘ăŽÓŒ^ƒOƒ‹ƒ^ƒ~ƒ“Ž_Žó—e‘Ě2qmGlu2rGLY354740‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7epb_40F$
7mtr‚ĚChain Ai‘ăŽÓŒ^ƒOƒ‹ƒ^ƒ~ƒ“Ž_Žó—e‘Ě2qmGlu2rGƒ|ƒWƒeƒBƒuƒAƒƒXƒeƒŠƒbƒN’˛ßˆöŽqADX55164‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7mtr_ZQY$ b PDBsumƒf[ƒ^7mts_ZQY$ b PDBsumƒf[ƒ^7mtq_Z99iLY341495j$
8jcyi‘ăŽÓŒ^ƒOƒ‹ƒ^ƒ~ƒ“Ž_Žó—e‘Ě2-“Ż3ƒwƒeƒ2—ʑ́qmGlu2-mGlu3ƒwƒeƒƒ_ƒCƒ}[rGƒAƒ“ƒ^ƒSƒjƒXƒgLY341495‚ŞŒ‹‡j@Z99iLY341495j‘I‘đ@“ŻPDBsumƒf[ƒ^8jcy_lp[2002(2)]$@mMetabotropic glutamate receptor 3 - Wikipedian
7wih‚ĚChain Ai‘ăŽÓŒ^ƒOƒ‹ƒ^ƒ~ƒ“Ž_Žó—e‘Ě3qmGlu3rGƒAƒSƒjƒXƒgLY2794193‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7wih_CWY$ b PDBsumƒf[ƒ^7wi6_Z99iLY341495j$@PDBsumƒf[ƒ^7wi8_Z99i“Żj$
4oo9i‘ăŽÓŒ^ƒOƒ‹ƒ^ƒ~ƒ“Ž_Žó—e‘Ě5qmGlu5rGƒlƒKƒeƒBƒuƒAƒƒXƒeƒŠƒbƒN’˛ßˆöŽqƒ}ƒ{ƒOƒ‹ƒ‰ƒ“ƒgqmavoglurantr‚ŞŒ‹‡j@2U8iƒ}ƒ{ƒOƒ‹ƒ‰ƒ“ƒgj‘I‘đ@“ŻPDBsumƒf[ƒ^4oo9_2U8$@mMetabotropic glutamate receptor 5 - WikipediaCAllosteric modulator - Wikipedian
5cgdi‘ăŽÓŒ^ƒOƒ‹ƒ^ƒ~ƒ“Ž_Žó—e‘Ě5qmGlu5rGƒlƒKƒeƒBƒuƒAƒƒXƒeƒŠƒbƒN’˛ßˆöŽqHTL14242‚ŞŒ‹‡j@51EiHTL14242j‘I‘đ@“ŻPDBsumƒf[ƒ^5cgd_51E$@¨ JmolƒgƒsƒbƒN
6n51i‘ăŽÓŒ^ƒOƒ‹ƒ^ƒ~ƒ“Ž_Žó—e‘Ě5qmGlu5rGƒiƒmƒ{ƒfƒB‚ĆL-ƒLƒXƒJƒ‹Ž_‚ŞŒ‹‡CKobilka‚ç‚É‚ć‚éj@QUSiL-ƒLƒXƒJƒ‹Ž_j‘I‘đ@“ŻPDBsumƒf[ƒ^6n51_QUS[903(B)]$ a @PDBsumƒf[ƒ^6n50_QUS[603(A)]$@mQuisqualic acid - Wikipedian
7fd9‚ĚChain Ai‘ăŽÓŒ^ƒOƒ‹ƒ^ƒ~ƒ“Ž_Žó—e‘Ě5qmGlu5rGƒIƒ‹ƒ\ƒXƒeƒŠƒbƒNƒAƒ“ƒ^ƒSƒjƒXƒgLY341495‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7fd9_Z99$ b PDBsumƒf[ƒ^7fd8_QUSiL-ƒLƒXƒJƒ‹Ž_j$
8tao‚ĚChain Bi‘ăŽÓŒ^ƒOƒ‹ƒ^ƒ~ƒ“Ž_Žó—e‘Ě5qmGlu5rGƒ|ƒWƒeƒBƒuƒAƒƒXƒeƒŠƒbƒNƒ‚ƒWƒ…ƒŒ[ƒ^[CDPPB‚ĆL-ƒLƒXƒJƒ‹Ž_‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8tao_YKUiCDPPBj$
2lnl‚ĚModel 1iCXCR1qIL-8AŽó—e‘Ě‚Ě•Ę–źrj@mChemokine receptor - WikipediaCCXC chemokine receptors - Wikipedian
8ic0‚ĚChain AEFiCXCR1GƒCƒ“ƒ^[ƒƒCƒLƒ“-8Œ‹‡j@Chain FiƒCƒ“ƒ^[ƒƒCƒLƒ“-8j‘I‘đ
8hnl‚ĚChain RiCXCR3GƒAƒSƒjƒXƒgPS372424Œ‹‡j@4AIiPS372424j‘I‘đ@“ŻPDBsumƒf[ƒ^8hnl_lp$
8k2w‚ĚChain RiCXCR3GƒAƒ“ƒ^ƒSƒjƒXƒgAMG487Œ‹‡j@FI6iAMG487j‘I‘đ@“ŻPDBsumƒf[ƒ^8k2w_lp$
3odu‚ĚChain A%iCXCR4GƒAƒ“ƒ^ƒSƒjƒXƒgIT1tŒ‹‡j@“ŻPDBsumƒf[ƒ^3odu_ITD$
4mbs‚ĚChain AiCCR5G‘jŠQÜƒ}ƒ‰ƒrƒƒNqmaravirocrŒ‹‡j@“ŻPDBsumƒf[ƒ^4mbs_MRV$@MRViƒ}ƒ‰ƒrƒƒNj‘I‘đ
6wwz‚ĚChain CERiCCR6G“ŕˆöŤƒ^ƒ“ƒpƒNŽżƒŠƒKƒ“ƒhCCL20Œ‹‡j@Chain CiCCL20j‘I‘đ
8kfy‚ĚChain RiCCR8GƒAƒSƒjƒXƒgZK 756326Œ‹‡j@“ŻPDBsumƒf[ƒ^8kfy_lp$
5lwe‚ĚChain AiCCR9G‘jŠQÜƒo[ƒT[ƒmƒ“qvercirnonrŒ‹‡j@“ŻPDBsumƒf[ƒ^5lwe_79KiMLIŠÜ‚ށj$@79Kiƒo[ƒT[ƒmƒ“j‘I‘đ
ŸƒRƒnƒNŽ_Žó—e‘ĚŠÖ˜A@mSUCNR1 - Wikipedian
6z10‚ĚChain AiƒRƒnƒNŽ_Žó—e‘Ě1GƒAƒ“ƒ^ƒSƒjƒXƒgŒ‹‡j@Q4TiƒAƒ“ƒ^ƒSƒjƒXƒgcompound 20j‘I‘đ@“ŻPDBsumƒf[ƒ^6z10_Q4T$
ŸƒRƒŒƒVƒXƒgƒLƒjƒ“Ž_Žó—e‘ĚŠÖ˜A@mCholecystokinin - WikipediaCCholecystokinin receptor - Wikipedian
7mbx‚ĚChain PERiƒRƒŒƒVƒXƒgƒLƒjƒ“1Žó—e‘́qCCK1Rrj@Chain PiƒRƒŒƒVƒXƒgƒLƒjƒ“8j‘I‘đ
7xov‚ĚChain RiƒRƒŒƒVƒXƒgƒLƒjƒ“1Žó—e‘́qCCK1RrGƒAƒSƒjƒXƒgSR146131‚ŞŒ‹‡j@@“ŻPDBsumƒf[ƒ^7xovR_lp$
7f8yiƒRƒŒƒVƒXƒgƒLƒjƒ“Žó—e‘́qCCKARrGƒfƒoƒ[ƒsƒh‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7f8y_1OZ$@mDevazepide - Wikipedian
5o9h‚ĚChain AiƒAƒ“ƒ^ƒSƒjƒXƒgNDT9513727‚ŞŒ‹‡‚ľ‚˝ƒAƒiƒtƒBƒ‰ƒgƒLƒVƒ“C5aŽó—e‘Ě1j@9P2iNDT9513727j‘I‘đ@“ŻPDBsumƒf[ƒ^5o9h_9P2$@mC5a receptor - Wikipedian
6c1riƒAƒ“ƒ^ƒSƒjƒXƒg‚ĚPMX53‚Ćavacopan‚ŞŒ‹‡‚ľ‚˝C5aŽó—e‘́j@Chain LiPMX53j‘I‘đ@EFDiavacopanj‘I‘đ@“ŻPDBsumƒf[ƒ^6c1r_PMX53iPMX53j$@“ŻPDBsumƒf[ƒ^6c1r_EFDsiavacopanG3‚‚ĚOLA‚Ć1‚‚ĚPGEœ‚­j$ a PDBsumƒf[ƒ^6c1q_9P2iNDT9513727j$
ŸƒXƒtƒBƒ“ƒSƒVƒ“-1-ƒŠƒ“Ž_Žó—e‘ĚŠÖ˜A@mSphingosine-1-phosphate receptor - Wikipedian
3v2yiƒXƒtƒBƒ“ƒSƒVƒ“-1-ƒŠƒ“Ž_Žó—e‘Ě1qS1PR1rj*%@“ŻPDBsumƒf[ƒ^3v2y_ML5$@mS1PR1 - Wikipedian
7eo4‚ĚChain AiƒXƒtƒBƒ“ƒSƒVƒ“-1-ƒŠƒ“Ž_Žó—e‘Ě1qS1PR1rGƒVƒ|ƒjƒ‚ƒhqsiponimodCBAF312r‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7eo4_J8C$@mSiponimod - Wikipedian a PDBsumƒf[ƒ^7wf7_S1PiƒXƒtƒBƒ“ƒSƒVƒ“-1-ƒŠƒ“Ž_j$@PDBsumƒf[ƒ^7eo2_J89iƒtƒBƒ“ƒSƒŠƒ‚ƒhqfingolimodCFTY720rj$
7td4‚ĚChain RiƒXƒtƒBƒ“ƒSƒVƒ“-1-ƒŠƒ“Ž_Žó—e‘Ě1qS1PR1rGƒVƒ|ƒjƒ‚ƒhqsiponimodCBAF312r‚ŞŒ‹‡j@J8CiƒVƒ|ƒjƒ‚ƒhj‘I‘đ@“ŻPDBsumƒf[ƒ^7td4_J8C$ b PDBsumƒf[ƒ^7td0_NKPiLPAj$@PDBsumƒf[ƒ^7td3_S1PiS1Pj$
7vig‚ĚChain FiƒXƒtƒBƒ“ƒSƒVƒ“-1-ƒŠƒ“Ž_Žó—e‘Ě1qS1PR1rGCBP-307‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7vig_7I4$
7c4s‚ĚChain AiƒXƒtƒBƒ“ƒSƒVƒ“-1-ƒŠƒ“Ž_Žó—e‘Ě3qS1PR3rj@“ŻPDBsumƒf[ƒ^7c4s_S1P$
7ew4‚ĚChain RiƒXƒtƒBƒ“ƒSƒVƒ“-1-ƒŠƒ“Ž_Žó—e‘Ě3qS1PR3rj@“ŻPDBsumƒf[ƒ^7ew4_JF9iCYM-5541j$
7yxa‚ĚChain AiƒXƒtƒBƒ“ƒSƒVƒ“-1-ƒŠƒ“Ž_Žó—e‘Ě5qS1PR5rGƒCƒ“ƒo[ƒXƒAƒSƒjƒXƒgONO-5430608‚ŞŒ‹‡j@B2OiONO-5430608j‘I‘đ@“ŻPDBsumƒf[ƒ^7yxa_B2O[2502(A)]$@mS1PR5 - Wikipedian
6wzg‚ĚChain PERiƒZƒNƒŒƒ`ƒ“Žó—e‘́GƒZƒNƒŒƒ`ƒ“‚ŞŒ‹‡j@Chain PiƒZƒNƒŒƒ`ƒ“j‘I‘đ
7d3s‚ĚChain PERiƒZƒNƒŒƒ`ƒ“Žó—e‘́GƒZƒNƒŒƒ`ƒ“‚ŞŒ‹‡j@Chain PiƒZƒNƒŒƒ`ƒ“j‘I‘đ
ŸƒXƒ€[ƒYƒ“ƒhŠÖ˜A@mSmoothened - Wikipedian
4jkv‚ĚChain AiƒXƒ€[ƒYƒ“ƒhGRŽîᇖňLY2940680‚ŞŒ‹‡j@1KSiLY2940680j‘I‘đ@“ŻPDBsumƒf[ƒ^4jkv_1KS$
6d32iƒXƒ€[ƒYƒ“ƒhG‘jŠQÜƒVƒNƒƒpƒ~ƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^6d32_CY8$ a PDBsumƒf[ƒ^6d35_CLRiƒRƒŒƒXƒeƒ[ƒ‹Œ‹‡j$
6o3c‚ĚChain AiƒXƒ€[ƒYƒ“ƒhGƒAƒSƒjƒXƒgSAG21k‚ĆƒRƒŒƒXƒeƒ[ƒ‹‚ŞŒ‹‡j@LKDiSAG21kj‘I‘đ@CLRiƒRƒŒƒXƒeƒ[ƒ‹j‘I‘đ@“ŻPDBsumƒf[ƒ^6o3c_LKDiSAG21kj$@“ŻPDBsumƒf[ƒ^6o3c_CLR[612(A)]iƒRƒŒƒXƒeƒ[ƒ‹j$
6ot0‚ĚChain RiƒXƒ€[ƒYƒ“ƒhG24,25-ƒGƒ|ƒLƒVƒRƒŒƒXƒeƒ[ƒ‹‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^6ot0_CO1$
6bd4iFrizzled 4Žó—e‘́j@mFrizzled - Wikipedian
6xbl‚ĚChain RiƒXƒ€[ƒYƒ“ƒhGƒAƒSƒjƒXƒgSAGŒ‹‡j@V0SiƒAƒSƒjƒXƒgSAGj‘I‘đ@“ŻPDBsumƒf[ƒ^6xbl_V0S$ b PDBsumƒf[ƒ^6xbm_CO1[701(R)]i24(S),25-ƒGƒ|ƒLƒVƒRƒŒƒXƒeƒ[ƒ‹j$


œŽó—e‘ĚŠÖ˜A (4)

Leu‘I‘đ@BCAA‹…•\ŽŚiLeu Ile Valj
ƒAƒ~ƒmF@ChainF@CPKF@a@JmolF@RasmolF a ”ZÔ@—΁@”Zƒsƒ“ƒN@žň
Ž_ŤE’†ŤE‰–ŠîŤ‹ć•Ę@‹ÉŤE”ń‹ÉŤ‹ć•Ę@‘a…ŤƒCƒ“ƒfƒbƒNƒX‡@I/O’l‡i“ÁŤŠî Rj@“™“d“_‡@ƒRƒ“ƒzƒ[ƒVƒ‡ƒ“‘I‘𐍁iƒżƒwƒŠƒbƒNƒXEƒŔƒXƒgƒ‰ƒ“ƒhj
…‘fŒ‹‡•\ŽŚ b S-SŒ‹‡•\ŽŚ@ b @
b ”wŒiE•@ŠD@”’@Ž
@Chain‘I‘đF A B C D E F G H I J K L M N O P
7e2y‚ĚChain Ri5-HT1AŽó—e‘́GƒZƒƒgƒjƒ“‚ŞŒ‹‡j@SROiƒZƒƒgƒjƒ“j‘I‘đ@PDBsumƒf[ƒ^7e2y_SRO$ b 7e2z‚ĚChain Ri5-HT1AŽó—e‘́GƒAƒŠƒsƒvƒ‰ƒ][ƒ‹‚ŞŒ‹‡j@9SCiƒAƒŠƒsƒvƒ‰ƒ][ƒ‹j‘I‘đ@“ŻPDBsumƒf[ƒ^7e2z_9SC$@m5-HT receptor - WikipediaC5-HT1 receptor - WikipediaCAripiprazole - Wikipedian a 7e33‚ĚChain Ri5-HT1EŽó—e‘́GBRL-54443‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7e33_HVU$@mBRL-54443 - Wikipedian
4iar*%i5-HT1B-BRILƒLƒƒ‰ƒ^ƒ“ƒpƒNŽżGƒGƒ‹ƒSƒ^ƒ~ƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^4iar_ERM$@mErgotamine - Wikipedian
5tud‚ĚChain A-Ci5-HT1B-‰Â—nŤƒVƒgƒNƒƒ€b562ƒLƒƒ‰ƒ^ƒ“ƒpƒNŽżGR‘ĚFabƒtƒ‰ƒOƒƒ“ƒg‚ĆƒGƒ‹ƒSƒ^ƒ~ƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^5tud_ERM$
5v54‚ĚChain Ai5-HT1BŽó—e‘́Gƒƒ`ƒIƒeƒsƒ“qmethiothepinG‚Ü‚˝‚̓ƒ`ƒeƒsƒ“ metitepiner‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^5v54_89F$
6g79i5-HT1BŽó—e‘́GGoƒ^ƒ“ƒpƒNŽż‚ĆƒAƒSƒjƒXƒg‚ĚƒhƒjƒgƒŠƒvƒ^ƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^6g79_EP5$@mDonitriptan - Wikipedian
7c61‚ĚChain Ai5-HT1BŽó—e‘́GƒGƒ‹ƒSƒ^ƒ~ƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7c61_ERM$
7exd‚ĚChain Ri5-HT1FŽó—e‘́GR•Đ“Ş’É–ňƒ‰ƒXƒ~ƒWƒ^ƒ“qƒ‰ƒXƒ~ƒfƒBƒ^ƒ“r‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7exd_05X$
6a94Chain Ai5-HT2AŽó—e‘́GR¸_•a–ňƒ]ƒeƒsƒ“‚ŞŒ‹‡j@ZOTiƒ]ƒeƒsƒ“j‘I‘đ@“ŻPDBsumƒf[ƒ^6a94_ZOT$ a PDBsumƒf[ƒ^6a93_8NUiƒyƒ“ƒ^ƒGƒ`ƒŒƒ“ƒOƒŠƒR[ƒ‹œ‚­j$@mRisperidone - WikipediaCZotepine - Wikipedian
6wha‚ĚChain Ai5-HT2AŽó—e‘́GŒśŠoÜ25-CN-NBOH‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^6wha_U0G$@m25-CN-NBOH - Wikipedian
7voei5-HT2AŽó—e‘́G“‡Ž¸’˛ÇŽĄ—Ă–ňƒAƒŠƒsƒvƒ‰ƒ][ƒ‹qaripiprazoler‚ŞŒ‹‡j@9SCiƒAƒŠƒsƒvƒ‰ƒ][ƒ‹j‘I‘đ@“ŻPDBsumƒf[ƒ^7voe_9SC$@mAripiprazole - WikipediaC7vod‚ÉŒ‹‡ Cariprazine - Wikipedian a PDBsumƒf[ƒ^7vod_7RUiƒJƒŠƒvƒ‰ƒWƒ“j$@mCariprazine - Wikipedian b ƒAƒŠƒsƒvƒ‰ƒ][ƒ‹iaripiprazolej ¨ “ú–{”­‚Ěˆă–ň•i
7wc6i5-HT2AŽó—e‘́GLSD‚ŞŒ‹‡j@7LDiLSDj‘I‘đ@“ŻPDBsumƒf[ƒ^7wc6_7LD$@¨ ŠëŒŻƒhƒ‰ƒbƒO b PDBsumƒf[ƒ^7wc4_SROiƒZƒƒgƒjƒ“j$@PDBsumƒf[ƒ^7wc5_91Q$@PDBsumƒf[ƒ^7wc7_H8GiƒŠƒXƒŠƒhj$@PDBsumƒf[ƒ^7wc8_92Siƒ‹ƒ}ƒeƒyƒƒ“j$@PDBsumƒf[ƒ^7wc9_93F$
7ran‚ĚChain Ai5-HT2AŽó—e‘́GƒAƒSƒjƒXƒgR-69‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7ranA_lp$
7um4‚ĚChain Ai5-HT5AŽó—e‘́GƒAƒ“ƒ^ƒSƒjƒXƒgAS2674723‚ŞŒ‹‡j@NN6iAS2674723j‘I‘đ@“ŻPDBsumƒf[ƒ^7um4A_lp$@m5-HT5A receptor - Wikipedian
4ib4*%i5-HT2B-BRILƒLƒƒ‰ƒ^ƒ“ƒpƒNŽżGƒGƒ‹ƒSƒ^ƒ~ƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^4ib4_ERM$@m5-HT2B receptor - Wikipedian
5tvniLSD‚ŞŒ‹‡‚ľ‚˝5-HT2BƒŒƒZƒvƒ^[j@7LDiLSDj‘I‘đ@Leu209‘I‘đ@“ŻPDBsumƒf[ƒ^5tvn_7LD$@¨ JmolƒgƒsƒbƒN
6ds0iƒAƒSƒjƒXƒg‚ĚLY266097‚ŞŒ‹‡‚ľ‚˝5-HT2BƒŒƒZƒvƒ^[j@H8MiLY266097j‘I‘đ@“ŻPDBsumƒf[ƒ^6ds0_H8M$ a PDBsumƒf[ƒ^6drx_H8G$ilisurideqƒŠƒXƒŠƒhrŒ‹‡j@PDBsumƒf[ƒ^6dry_H8D$imethylergonovineqƒƒ`ƒ‹ƒGƒ‹ƒSƒƒgƒŠƒ“rŒ‹‡j@PDBsumƒf[ƒ^6drz_H8J$imethysergideqƒƒ`ƒZƒ‹ƒWƒhrŒ‹‡j
6bqhi5-HT2CŽó—e‘́GƒŠƒ^ƒ“ƒZƒŠƒ“‚ŞŒ‹‡j@E2JiƒŠƒ^ƒ“ƒZƒŠƒ“j‘I‘đ@“ŻPDBsumƒf[ƒ^6bqh_E2J$@m5-HT2C receptor - WikipediaCRitanserin - Wikipedian a PDBsumƒf[ƒ^6bqg_ERMiƒGƒ‹ƒSƒ^ƒ~ƒ“Œ‹‡j$
8dpi‚ĚChain Ai5-HT2CŽó—e‘́Gƒƒ‹ƒJƒZƒŠƒ“‚ŞŒ‹‡j@T4Uiƒƒ‹ƒJƒZƒŠƒ“j‘I‘đ@“ŻPDBsumƒf[ƒ^8dpi_T4U$
6y5a‚ĚChain Ai5-HT3AŽó—e‘́GƒZƒƒgƒjƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^6y5a_SRO$@m5-HT3 receptor - Wikipedian
7x5h‚ĚChain Ri5-HT5AŽó—e‘́G5-ƒJƒ‹ƒ{ƒLƒTƒ~ƒhƒgƒŠƒvƒ^ƒ~ƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7x5h_lp$@m5-HT5A receptor - Wikipedian
7ys6‚ĚChain Ai5-HT6Žó—e‘́GƒZƒƒgƒjƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7ys6_SRO$@m5-HT6 receptor - Wikipedian
8jlz‚ĚChain Ri5-HT6Žó—e‘́G‘I‘đ“IƒAƒSƒjƒXƒgST1936‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8jlz_lp$@mST-1936 - Wikipedian
7xtc‚ĚChain Ri5-HT7Žó—e‘́G5-ƒJƒ‹ƒ{ƒLƒTƒ~ƒhƒgƒŠƒvƒ^ƒ~ƒ“‚ŞŒ‹‡j@8K3‘I‘đ@“ŻPDBsumƒf[ƒ^7xtc_8K3$@m5-HT7 receptor - Wikipedian
3gwviƒZƒƒgƒjƒ“ƒgƒ‰ƒ“ƒXƒ|[ƒ^[Gƒtƒ‹ƒIƒLƒZƒ`ƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^ 3gwv_RFX$@mSerotonin transporter - Wikipedian
7lwd‚ĚChain AiƒZƒƒgƒjƒ“ƒgƒ‰ƒ“ƒXƒ|[ƒ^[Gƒrƒ‰ƒ]ƒhƒ“qvilazodoner‚ŞŒ‹‡j@YG7iƒrƒ‰ƒ]ƒhƒ“j‘I‘đ@“ŻPDBsumƒf[ƒ^ 7lwd_YG7$@mVilazodone - Wikipedian
7wig‚ĚChain Riƒ\ƒ}ƒgƒXƒ^ƒ`ƒ“Žó—e‘Ě2qSSTR2rGL-054,264Œ‹‡j@“ŻPDBsumƒf[ƒ^7wigR_lp$@mSomatostatin receptor - Wikipedian
7yac‚ĚChain Eiƒ\ƒ}ƒgƒXƒ^ƒ`ƒ“Žó—e‘Ě2qSSTR2rGpaltusotineŒ‹‡j@“ŻPDBsumƒf[ƒ^7yac_lp$
7bw0‚ĚChain Ri’_`Ž_Žó—e‘Ě1qGPCR19CTGR5rj@mG protein-coupled bile acid receptor - Wikipedian
7cfn‚ĚChain Ri’_`Ž_Žó—e‘Ě1qGPBAR1rj@FX0iINT-777j‘I‘đ@“ŻPDBsumƒf[ƒ^7cfn_FX0[403(R)]$ a PDBsumƒf[ƒ^7cfm_FWXiP395Œ‹‡j$
7xtq‚ĚChain Ri’_`Ž_Žó—e‘́qGPBARrj@“ŻPDBsumƒf[ƒ^7xtqR_lp$
7jv5‚ĚChain Riƒh[ƒpƒ~ƒ“D1Žó—e‘́GƒAƒSƒjƒXƒgSKF-81297Œ‹‡j@SK0iSKF-81297j‘I‘đ@“ŻPDBsumƒf[ƒ^7jv5_SK0$@mDopamine receptor D1 - WikipediaCSKF-81,297 - Wikipedia
7ljc‚ĚChain Riƒh[ƒpƒ~ƒ“D1Žó—e‘́GƒAƒSƒjƒXƒgSKF-81297Œ‹‡‚Ćƒ|ƒWƒeƒBƒuƒAƒƒXƒeƒŠƒbƒN’˛ßˆöŽqLY3154207j@SK0iSKF-81297j‘I‘đ@G4CiLY3154207j‘I‘đ@“ŻPDBsumƒf[ƒ^7ljc_SK0iSKF-81297j$@“ŻPDBsumƒf[ƒ^7ljc_G4CiLY3154207j$ b PDBsumƒf[ƒ^7ljd_G4CiLY3154207j$
7cky‚ĚChain Riƒh[ƒpƒ~ƒ“D1Žó—e‘́GƒAƒSƒjƒXƒgPW0464Œ‹‡j@G3UiPW0464j‘I‘đ@“ŻPDBsumƒf[ƒ^7cky_G3U$ b PDBsumƒf[ƒ^7ckx_G3OiA77636j$@PDBsumƒf[ƒ^7crh_GBUiSKF83959j$@PDBsumƒf[ƒ^7ckz_G4CiLY3154207j$
7joz‚ĚChain Riƒh[ƒpƒ~ƒ“D1Žó—e‘́G”ńƒJƒeƒR[ƒ‹ƒAƒSƒjƒXƒgŒ‹‡j@G3UiPW0464j‘I‘đ@“ŻPDBsumƒf[ƒ^7joz_VFP$
7x2c‚ĚChain Fiƒh[ƒpƒ~ƒ“D1Žó—e‘́GƒAƒSƒjƒXƒg‚ĚƒtƒFƒmƒ‹ƒhƒpƒ€Œ‹‡j@G3CiƒtƒFƒmƒ‹ƒhƒpƒ€j‘I‘đ@“ŻPDBsumƒf[ƒ^7x2cF_lp[503(F)]$ b PDBsumƒf[ƒ^7x2dF_lpiƒ^ƒoƒpƒhƒ“j$@mFenoldopam - WikipediaCTavapadon - Wikipedia
1i15iƒh[ƒpƒ~ƒ“D2Žó—e‘́GTheoretical ModelCƒż˝•”•Ş‚̂݁j@mDopamine receptor D2 - Wikipedian
6c38iƒh[ƒpƒ~ƒ“D2Žó—e‘́GƒŠƒXƒyƒŠƒhƒ“Œ‹‡j@8NUiƒŠƒXƒyƒŠƒhƒ“j‘I‘đ b 6cm4iƒh[ƒpƒ~ƒ“D2Žó—e‘́q6c38‚̍XVƒf[ƒ^rGƒŠƒXƒyƒŠƒhƒ“Œ‹‡j@8NUiƒŠƒXƒyƒŠƒhƒ“j‘I‘đ@“ŻPDBsumƒf[ƒ^6cm4_8NU$
6vms‚ĚChain Riƒh[ƒpƒ~ƒ“D2Žó—e‘́Gƒuƒƒ‚ƒNƒŠƒvƒ`ƒ“qbromoergocryptinerŒ‹‡j@“ŻPDBsumƒf[ƒ^6vms_08Y$
7dfp‚ĚChain Aiƒh[ƒpƒ~ƒ“D2Žó—e‘́GR¸_–ňƒXƒsƒyƒƒ“qspiperonerŒ‹‡j@“ŻPDBsumƒf[ƒ^7dfp_SIP$@mSpiperone - Wikipedian
3pbl%iƒh[ƒpƒ~ƒ“D3Žó—e‘́GƒGƒ`ƒNƒƒvƒŠƒhŒ‹‡j@“ŻPDBsumƒf[ƒ^3pbl_ETQ$@mDopamine receptor D3 - Wikipedian
7cmv‚ĚChain Riƒh[ƒpƒ~ƒ“D3Žó—e‘́GƒAƒSƒjƒXƒgPD128907Œ‹‡j@“ŻPDBsumƒf[ƒ^7cmv_G6O$@mPD-128,907 - Wikipedian b PDBsumƒf[ƒ^7cmu_G6Liƒvƒ‰ƒ~ƒyƒLƒ\[ƒ‹j$
5wiviƒh[ƒpƒ~ƒ“D4Žó—e‘́Gƒlƒ}ƒgƒvƒŠƒhŒ‹‡j@AQDiƒlƒ}ƒgƒvƒŠƒhj‘I‘đ@“ŻPDBsumƒf[ƒ^5wiv_AQD$@mDopamine receptor D4 - WikipediaCNemonapride - Wikipedian
6iql‚ĚChain Aiƒh[ƒpƒ~ƒ“D4Žó—e‘́GƒAƒ“ƒ^ƒSƒjƒXƒgL745870Œ‹‡j@“ŻPDBsumƒf[ƒ^6iql_L74$
8irv‚ĚChain Riƒh[ƒpƒ~ƒ“D5Žó—e‘́GƒAƒSƒjƒXƒg‚Ěƒƒ`ƒSƒ`ƒ“Œ‹‡j@R5Fiƒƒ`ƒSƒ`ƒ“j‘I‘đ@“ŻPDBsumƒf[ƒ^8irv_R5F$@mDopamine receptor D5 - WikipediaCRotigotine - Wikipedian
4grviƒjƒ…[ƒƒeƒ“ƒVƒ“Žó—e‘Ě1qNTSR1rGƒjƒ…[ƒƒeƒ“ƒVƒ“q•”•ŞC6ŽcŠî/13ŽcŠîrŒ‹‡j@“ŻPDBsumƒf[ƒ^4grv_RRPYIL[Chain B]$@mNeurotensin receptor - Wikipedian
6up7‚ĚChain CERiƒqƒgƒjƒ…[ƒƒeƒ“ƒVƒ“Žó—e‘Ě1GChain BiƒŔ-ƒAƒŒƒXƒ`ƒ“1jEVœ‚­CKobilka‚ç‚É‚ć‚éj@Chain CiARG-ARG-PRO-TYR-ILE-LEUj‘I‘đ
8fn0‚ĚChain Aiƒjƒ…[ƒƒeƒ“ƒVƒ“Žó—e‘Ě1qNTSR1rGƒAƒƒXƒeƒŠƒbƒN’˛ßˆöŽqŒ‹‡j@“ŻPDBsumƒf[ƒ^8fn0_SRW$
8jpfiƒjƒ…[ƒƒeƒ“ƒVƒ“Žó—e‘Ě1qNTSR1rGƒjƒ…[ƒƒeƒ“ƒVƒ“q•”•ŞC6ŽcŠî/13ŽcŠîr‚ĆSBI-553Œ‹‡j@Chain Liƒjƒ…[ƒƒeƒ“ƒVƒ“j‘I‘đ@“ŻPDBsumƒf[ƒ^8jpf_lp$
3rze*%iƒqƒXƒ^ƒ~ƒ“H1Žó—e‘́GƒhƒLƒZƒsƒ“ŠÜ‚ށi5EH‚ĆD7V‚Ě2\‘˘d‚ˍ‡‚í‚šjj@5EHi3E‘́jÁ‹Ž@D7Vi3Z‘́jÁ‹Ž@“ŻPDBsumƒf[ƒ^3rze_5EH-D7V$@5EHi3E‘́j‚Ě‚Ý•\ŽŚ@D7Vi3Z‘́j‚Ě‚Ý•\ŽŚ@mHistamine H1 receptor - WikipediaCDoxepin - Wikipedian
7yfd‚ĚChain AiƒqƒXƒ^ƒ~ƒ“H3Žó—e‘́GƒAƒ“ƒ^ƒSƒjƒXƒgPF-03654746Œ‹‡j@mHistamine H3 receptor - WikipediaCPF-03654746 - Wikipedian
7yfd‚ĚChain RiƒqƒXƒ^ƒ~ƒ“H4Žó—e‘́G‘I‘đ“IƒAƒSƒjƒXƒg ƒCƒƒ`ƒbƒgqimetitrŒ‹‡j@“ŻPDBsumƒf[ƒ^7yfd_lp$@¨ JmolƒgƒsƒbƒNiƒAƒgƒs[Ť”畆‰ŠŠÖ˜Aj@mHistamine H4 receptor - WikipediaCImetit - Wikipedian
8hoc‚ĚChain RiƒqƒXƒ^ƒ~ƒ“H4Žó—e‘́GƒCƒƒ`ƒbƒgqimetitrŒ‹‡j@“ŻPDBsumƒf[ƒ^8hoc_lp$
8j22‚ĚChain CiFFAR2q—V—ŁŽ‰–bŽ_Žó—e‘Ě2rGƒAƒSƒjƒXƒgTUG-1375‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8j22_lp$
8iys‚ĚChain RiFFAR4q—V—ŁŽ‰–bŽ_Žó—e‘Ě4rCGPR120GƒAƒSƒjƒXƒgTUG-891‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8iys_lpiTUG-891j$
8t3o‚ĚChain Ri—V—ŁŽ‰–bŽ_Žó—e‘Ě4qFFA4rCGPR120GƒAƒSƒjƒXƒgTUG-891Œ‹‡j@“ŻPDBsumƒf[ƒ^8t3o_lp$
8jso‚ĚChain Ri”÷—ĘƒAƒ~ƒ“ŠÖ˜AŽó—e‘Ě1qTAAR1rGƒfƒLƒXƒgƒƒAƒ“ƒtƒFƒ^ƒ~ƒ“Œ‹‡j@“ŻPDBsumƒf[ƒ^8jso_lp$@mTrace amine-associated receptor - WikipediaCTAAR1 - Wikipedian
8uhb‚ĚChain Ai”÷—ĘƒAƒ~ƒ“ŠÖ˜AŽó—e‘Ě1qTAAR1rGƒAƒSƒjƒXƒgRo5256390Œ‹‡j@UJLiSEP-363856j‘I‘đ@“ŻPDBsumƒf[ƒ^8uhb_lp$@mRO5256390 - Wikipedian
8w8b‚ĚChain Ri”÷—ĘƒAƒ~ƒ“ŠÖ˜AŽó—e‘Ě1qTAAR1rGƒAƒSƒjƒXƒgSEP-363856Œ‹‡j@UJLiSEP-363856j‘I‘đ@“ŻPDBsumƒf[ƒ^8w8b_lp$
8wc7‚ĚChain Ri”÷—ĘƒAƒ~ƒ“ŠÖ˜AŽó—e‘Ě1qTAAR1rGƒAƒSƒjƒXƒgZH8667Œ‹‡j@UJLiSEP-363856j‘I‘đ@“ŻPDBsumƒf[ƒ^8wc7_lp$
8iwei”÷—ĘƒAƒ~ƒ“ŠÖ˜AŽó—e‘Ě9GƒXƒyƒ‹ƒ~ƒWƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8iwe_lp$ b PDBsumƒf[ƒ^8iwm_lpi2-ƒtƒFƒjƒ‹ƒGƒ`ƒ‹ƒAƒ~ƒ“j$@mOlfactory receptor - WikipediaCTAAR9 - Wikipedian
4ntj*iP2Y12Žó—e‘́GƒAƒ“ƒ^ƒSƒjƒXƒgAZD1283‚ŞŒ‹‡j@AZJiAZD1283j‘I‘đ@“ŻPDBsumƒf[ƒ^4ntj_AZJ$@mP2Y receptor - WikipediaCP2Y12 - Wikipedian
7xxi‚ĚChain AiP2Y12Žó—e‘́GƒAƒSƒjƒXƒg2MeSADP‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7xxi_6AD$
7ad3‚ĚChain BEHiƒtƒFƒƒ‚ƒ“Žó—e‘́qƒNƒ‰ƒXD GPCRCSte2rj@m
Fungal mating pheromone receptors - Wikipedian
7qbiiƒtƒFƒƒ‚ƒ“ƒż-ƒtƒ@ƒNƒ^[Žó—e‘́qSte2rj@Chain IEKiƒż-ƒtƒ@ƒNƒ^[ƒtƒFƒƒ‚ƒ“j‘I‘đ
4k5y*i‘jŠQÜCP-376395‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^4pxz_6AD[Chain A]$@1Q5‘I‘đ@mCorticotropin releasing hormone receptor 1 - WikipediaCCorticotropin-releasing hormone - Wikipedian
6p9x‚ĚChain PERi•›t”玿ŽhŒƒƒzƒ‹ƒ‚ƒ“•úoƒzƒ‹ƒ‚ƒ“qƒRƒ‹ƒ`ƒRƒŠƒxƒŠƒ“r‚ŞŒ‹‡‚ľ‚˝•›t”玿ŽhŒƒƒzƒ‹ƒ‚ƒ“•úoˆöŽqŽó—e‘Ě1qCRHR1CCRF1rj
8gti‚ĚChain AiƒAƒ“ƒ^ƒSƒjƒXƒgBMK-C205‚ŞŒ‹‡‚ľ‚˝•›t”玿ŽhŒƒƒzƒ‹ƒ‚ƒ“•úoˆöŽqŽó—e‘Ě1qCRF1Rrj@0JS‘I‘đ@“ŻPDBsumƒf[ƒ^8gti_0JS$
ŸƒvƒƒXƒ^ƒOƒ‰ƒ“ƒWƒ“Žó—e‘ĚŠÖ˜A@¨ ƒvƒƒXƒ^ƒOƒ‰ƒ“ƒWƒ“•ŞŽqƒf[ƒ^W
6d26iƒvƒƒXƒ^ƒOƒ‰ƒ“ƒWƒ“D2Žó—e‘Ě2qCRTH2rFƒtƒFƒrƒsƒvƒ‰ƒ“ƒg‚ŞŒ‹‡j@FSYiƒtƒFƒrƒsƒvƒ‰ƒ“ƒgj‘I‘đ@“ŻPDBsumƒf[ƒ^6d26_FSY$ a PDBsumƒf[ƒ^6d27_FT4iCAY10471Œ‹‡j$@mProstaglandin DP2 receptor - Wikipedian
7cx3‚ĚChain RiƒvƒƒXƒ^ƒOƒ‰ƒ“ƒWƒ“E2Žó—e‘Ě2qEP2rFƒ^ƒvƒŒƒlƒpƒO‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7cx3_GNO$ b PDBsumƒf[ƒ^7cx4_GM9iƒGƒoƒ^ƒlƒpƒOj$ b PDBsumƒf[ƒ^7cx2_P2EiƒvƒƒXƒ^ƒOƒ‰ƒ“ƒWƒ“E2j$@mProstaglandin E2 receptor - WikipediaCProstaglandin EP2 receptor - Wikipedian
6m9tiƒvƒƒXƒ^ƒOƒ‰ƒ“ƒWƒ“E2Žó—e‘Ě3qEP3rFƒ~ƒ\ƒvƒƒXƒg[ƒ‹-FA‚ŞŒ‹‡j@J9Piƒ~ƒ\ƒvƒƒXƒg[ƒ‹j‘I‘đ@“ŻPDBsumƒf[ƒ^6m9t_J9P$@mProstaglandin EP3 receptor - Wikipedian
5ywyiƒvƒƒXƒ^ƒOƒ‰ƒ“ƒWƒ“E2Žó—e‘Ě4qEP4rF‘jŠQR‘Ě‚ĆƒAƒ“ƒ^ƒSƒjƒXƒgONO-AE3-208‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^5ywy_7UR$@PDBsumƒf[ƒ^5yhl_8VLiONO-AE3-208L‘f‘́j$ a PDBsumƒf[ƒ^6ak3_P2EiƒvƒƒXƒ^ƒOƒ‰ƒ“ƒWƒ“E2j$@mProstaglandin EP4 receptor - Wikipedian
7d7m‚ĚChain AiƒvƒƒXƒ^ƒOƒ‰ƒ“ƒWƒ“E2Žó—e‘Ě4qEP4rFƒvƒƒXƒ^ƒOƒ‰ƒ“ƒWƒ“E2‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7d7m_P2E$
8gcm‚ĚChain RiƒvƒƒXƒ^ƒOƒ‰ƒ“ƒWƒ“E2Žó—e‘Ě4qEP4rj@“ŻPDBsumƒf[ƒ^8gcm_lp$
8gda‚ĚChain RiƒvƒƒXƒ^ƒOƒ‰ƒ“ƒWƒ“E2Žó—e‘Ě4qEP4rGƒAƒSƒjƒXƒgL902688‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8gda_lp$
8iuk‚ĚChain RiƒvƒƒXƒ^ƒOƒ‰ƒ“ƒWƒ“F2ƒżŽó—e‘́rFƒvƒƒXƒ^ƒOƒ‰ƒ“ƒWƒ“F2ƒż‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8iuk_lp$ b PGF2ƒż
8iq4‚ĚChain RiƒvƒƒXƒ^ƒOƒ‰ƒ“ƒWƒ“F2ƒżŽó—e‘́rFƒAƒSƒjƒXƒg‚ĚƒJƒ‹ƒ{ƒvƒƒXƒgqcarboprostr‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^8iq4_lp$@mCarboprost - Wikipedian
7xw6‚ĚChain Ribó‘BŽhŒƒƒzƒ‹ƒ‚ƒ“Žó—e‘́GƒAƒSƒjƒXƒgML-109Œ‹‡j@HOIiƒAƒSƒjƒXƒgML-109j‘I‘đ@“ŻPDBsumƒf[ƒ^7xw6R_lp$@mThyrotropin receptor - Wikipedian
7t9m‚ĚChain Ribó‘BŽhŒƒƒzƒ‹ƒ‚ƒ“Žó—e‘́j
8gw8‚ĚChain AERi•›bó‘Bƒzƒ‹ƒ‚ƒ“1Œ^Žó—e‘́qPTH1RrGě“Ž–ňPCO371Œ‹‡j@Chain AiGƒżƒTƒuƒ†ƒjƒbƒgj‘I‘đ@“ŻPDBsumƒf[ƒ^8gw8_lp$@mParathyroid hormone 1 receptor - Wikipedian
8jr9‚ĚChain AERi•›bó‘Bƒzƒ‹ƒ‚ƒ“1Œ^Žó—e‘́qPTH1RrGƒAƒSƒjƒXƒgPCO371Œ‹‡j@“ŻPDBsumƒf[ƒ^8jr9_lp$
7br3iŤ‘BŽhŒƒƒzƒ‹ƒ‚ƒ“•úoƒzƒ‹ƒ‚ƒ“Žó—e‘́qGnRH1Rrj@F5O‘I‘đ@“ŻPDBsumƒf[ƒ^7br3_F5O$@mGonadotropin-releasing hormone receptor - Wikipedian
7cz5‚ĚChain PERiŹ’ˇƒzƒ‹ƒ‚ƒ“•úoƒzƒ‹ƒ‚ƒ“Žó—e‘́qGHRHRrj@Chain PiŹ’ˇƒzƒ‹ƒ‚ƒ“•úoƒzƒ‹ƒ‚ƒ“qGHRHrj‘I‘đ@mGrowth-hormone-releasing hormone receptor - Wikipedian
7na8‚ĚChain RiŹ’ˇƒzƒ‹ƒ‚ƒ“•Ş”ĺ‘ŁiˆöŽqŽó—e‘́qGHSRCƒOƒŒƒŠƒ“Žó—e‘́rGƒCƒuƒ^ƒ‚ƒŒƒ“qibutamorenrŒ‹‡j@“ŻPDBsumƒf[ƒ^7na8_1KD$@mGrowth hormone secretagogue receptor - WikipediaCIbutamoren - Wikipedian
7f83‚ĚChain AiŹ’ˇƒzƒ‹ƒ‚ƒ“•Ş”ĺ‘Łi•¨ŽżŽó—e‘Ěƒ^ƒCƒv1qGHSRrGƒCƒ“ƒo[ƒXƒAƒSƒjƒXƒgŒ‹‡j@“ŻPDBsumƒf[ƒ^7f83_1KQ$
8i2g‚ĚChain Ri—‘–EŽhŒƒƒzƒ‹ƒ‚ƒ“Žó—e‘́Gcompound 21fŒ‹‡j@O6Ficompound 21fj‘I‘đ@“ŻPDBsumƒf[ƒ^8i2g_O6F$@mFollicle-stimulating hormone receptor - Wikipedian
5x2m‚ĚChain AEBiƒOƒ‹ƒ^ƒ~ƒ“‚ŞŒ‹‡‚ľ‚˝–ĄŠoŽó—e‘ĚT1r2-T1r3ƒwƒeƒ“ń—ʑ́j@GLNiƒŠƒKƒ“ƒh‚ĚƒOƒ‹ƒ^ƒ~ƒ“j‘I‘đ@“ŻPDBsumƒf[ƒ^5x2m_GLN[951(A)]$@“ŻPDBsumƒf[ƒ^5x2m_GLN[951(B)]$@“ŻPDBsumƒf[ƒ^5x2m_GLN[951(D)]$@¨ JmolƒgƒsƒbƒN‚É‘ź‚ĚPDBsumƒf[ƒ^@mTaste receptor - WikipediaCTAS1R2 - Wikipedian
7xp6‚ĚChain RiƒXƒgƒŠƒLƒj[ƒl‚ŞŒ‹‡‚ľ‚˝‹ę–ĄŽó—e‘́j@“ŻPDBsumƒf[ƒ^7xp6_lp[951(B)]$@mTAS2R46 - Wikipedian b ƒXƒgƒŠƒLƒj[ƒlistrychninej
8jmh‚ĚChain AiƒXƒNƒ[ƒX‚ŞŒ‹‡‚ľ‚˝–ĄŠoŽó—e‘ĚGr64aGGRƒtƒ@ƒ~ƒŠ[qGRsr‚ÍGPCR‚É“ü‚ę‚Č‚˘ę‡‚ŕ‚ ‚éj@“ŻPDBsumƒf[ƒ^8jmh_lp$
6me2iƒƒ‰ƒgƒjƒ“Žó—e‘ĚMT1Gƒ‰ƒƒ‹ƒeƒIƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^6me2_JEV$@mMelatonin receptor - Wikipedian a PDBsumƒf[ƒ^6me3_JEYi2-ƒtƒFƒjƒ‹ƒƒ‰ƒgƒjƒ“Œ‹‡j@PDBsumƒf[ƒ^6me4_ML2i2-ƒˆ[ƒhƒƒ‰ƒgƒjƒ“Œ‹‡j@m2-Iodomelatonin - Wikipedian@PDBsumƒf[ƒ^6me5_AWYiƒAƒSƒƒ‰ƒ`ƒ“Œ‹‡j
7db6‚ĚChain Diƒƒ‰ƒgƒjƒ“Žó—e‘ĚMT1Gƒ‰ƒƒ‹ƒeƒIƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^7db6_JEV$@mRamelteon - Wikipedian
7vgy‚ĚChain Aiƒƒ‰ƒgƒjƒ“Žó—e‘ĚMT1G2-ƒˆ[ƒhƒƒ‰ƒgƒjƒ“‚ŞŒ‹‡j@ML2i2-ƒˆ[ƒhƒƒ‰ƒgƒjƒ“j‘I‘đ@“ŻPDBsumƒf[ƒ^7vgy_ML2$ a PDBsumƒf[ƒ^7vgz_JEViMT1Cƒ‰ƒƒ‹ƒeƒIƒ“j$@PDBsumƒf[ƒ^7vh0_JEViMT2Cƒ‰ƒƒ‹ƒeƒIƒ“j$
6me9‚ĚChain Aiƒƒ‰ƒgƒjƒ“Žó—e‘ĚMT2Gƒ‰ƒƒ‹ƒeƒIƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^6me9_JEV [2201(A)]$ a PDBsumƒf[ƒ^6me6_JEY [2201(A)]i2-ƒtƒFƒjƒ‹ƒƒ‰ƒgƒjƒ“Œ‹‡j@PDBsumƒf[ƒ^6me7_JEY [2201(A)]i“Żj@PDBsumƒf[ƒ^6me8_JEY [2201(A)]i“Żj
6w25iƒƒ‰ƒmƒRƒ‹ƒ`ƒ“4Žó—e‘́qMC4RrGƒAƒ“ƒ^ƒSƒjƒXƒgSHU9119Œ‹‡j@Chain BiSHU9119j‘I‘đ@mMelanocortin 4 receptor - Wikipedian
7aue‚ĚChain Riƒƒ‰ƒmƒRƒ‹ƒ`ƒ“4Žó—e‘́qMC4Rrj
7f58‚ĚChain Riƒƒ‰ƒmƒRƒ‹ƒ`ƒ“4Žó—e‘́qMC4Rrj@“ŻPDBsumƒf[ƒ^7f58_1I8$@mTHIQ - Wikipedian
5x33iƒƒCƒRƒgƒŠƒGƒ“B4Žó—e‘́GhR–ňBIIL260Œ‹‡j@“ŻPDBsumƒf[ƒ^5x33_7Y9$@mLeukotriene receptor - Wikipedian
7vkt‚ĚChain AiƒƒCƒRƒgƒŠƒGƒ“Žó—e‘Ě1GƒƒCƒRƒgƒŠƒGƒ“B4Œ‹‡j@LTBiƒƒCƒRƒgƒŠƒGƒ“B4j‘I‘đ@“ŻPDBsumƒf[ƒ^7vkt_LTB$@mLeukotriene B4 - Wikipedian
6rz5‚ĚChain AiƒVƒXƒeƒCƒjƒ‹ƒƒCƒRƒgƒŠƒGƒ“Žó—e‘Ě1GƒUƒtƒBƒ‹ƒ‹ƒJƒXƒgŒ‹‡j@ZLKiƒUƒtƒBƒ‹ƒ‹ƒJƒXƒgj‘I‘đ@“ŻPDBsumƒf[ƒ^6rz5_ZLK[2001(A)]$@mZafirlukast - Wikipedian b PDBsumƒf[ƒ^6rz4_KNTiƒvƒ‰ƒ“ƒ‹ƒJƒXƒgŒ‹‡j$@mPranlukast - Wikipedian
6rz9iƒVƒXƒeƒCƒjƒ‹ƒƒCƒRƒgƒŠƒGƒ“Žó—e‘Ě2GONO-2770372Œ‹‡j@KO5iONO-2770372j‘I‘đ@KAZiNF-56-EJ40j‘I‘đ@“ŻPDBsumƒf[ƒ^6rz9_KO5$ b PDBsumƒf[ƒ^6rz6_KNWiONO-2570366Œ‹‡j$ b PDBsumƒf[ƒ^6rz7_KNWi“Żj$ b PDBsumƒf[ƒ^6rz8_KNZiONO-2080365Œ‹‡j$
BILF1 7jhj‚ĚChain RiƒqƒgƒÁƒwƒ‹ƒyƒXƒEƒCƒ‹ƒX4‚ĚBILF1CKobilka‚ç‚É‚ć‚éj@“ŻPDBsumƒf[ƒ^7jhj_Y01$
MasŠÖ˜AGƒ^ƒ“ƒpƒNŽż‹¤–đŒ^Žó—e‘ĚDiMrgDj 7y12‚ĚChain RiMasŠÖ˜AGƒ^ƒ“ƒpƒNŽż‹¤–đŒ^Žó—e‘ĚDj@Ser234‹óŠÔ[“U^ƒż’Y‘fƒ‰ƒxƒ‹•\ŽŚ@“ŻPDBsumƒf[ƒ^7y12_BALiƒŔ-ƒAƒ‰ƒjƒ“j$@mMRGPRD - Wikipedian
PAC1Žó—e‘́i”]‰ş‚‘ĚŒă—tƒAƒfƒjƒ‹Ž_ƒVƒNƒ‰[ƒ[1Œ^Žó—e‘́j 6lpb‚ĚChain PERiPAC1Žó—e‘́G”]‰ş‚‘ĚƒAƒfƒjƒ‹Ž_ƒVƒNƒ‰[ƒ[ŠˆŤ‰ťƒyƒvƒ`ƒhqPACAPr‚ŞŒ‹‡j@Chain PiPACAPj‘I‘đ@mADCYAP1R1 - Wikipedian
ƒAƒhƒq[ƒWƒ‡ƒ“Žó—e‘Ě 7d76‚ĚChain RiƒAƒhƒq[ƒWƒ‡ƒ“Žó—e‘ĚGPR97j@GXRiƒxƒNƒƒƒ^ƒ]ƒ“j‘I‘đ@“ŻPDBsumƒf[ƒ^7d76_GXR$ b PDBsumƒf[ƒ^7d77_HCY$@mAdhesion G protein-coupled receptor - Wikipedian
ƒAƒyƒŠƒ“Žó—e‘Ě 7w0l‚ĚChain QiƒAƒyƒŠƒ“Žó—e‘́j@“ŻPDBsumƒf[ƒ^7w0l_8EH[401(Q)]$@mApelin receptor - Wikipedian
‰Š‘ĚŒ`Źƒzƒ‹ƒ‚ƒ“/ăO–ѐŤƒSƒiƒhƒgƒƒsƒ“Žó—e‘Ě 7fih‚ĚChain Ri‰Š‘ĚŒ`Źƒzƒ‹ƒ‚ƒ“/ăO–ѐŤƒSƒiƒhƒgƒƒsƒ“Žó—e‘́j@“ŻPDBsumƒf[ƒ^7fih_55Z$@mOxytocin receptor - WikipediaCLuteinizing hormone/choriogonadotropin receptor - Wikipedian
ƒKƒXƒgƒŠƒ“•úoƒyƒvƒ`ƒhŽó—e‘Ě (GRPR) 7w41iƒKƒXƒgƒŠƒ“•úoƒyƒvƒ`ƒhŽó—e‘́qGRPRrGƒAƒ“ƒ^ƒSƒjƒXƒg PD176252Œ‹‡j@“ŻPDBsumƒf[ƒ^7w41_lp$@mGalanin receptor - WikipediaCGastrin-releasing peptide receptor - Wikipedian
ƒKƒ‰ƒjƒ“Žó—e‘Ě 7xbd‚ĚChain AEFiƒKƒ‰ƒjƒ“Žó—e‘Ě2qGALR2rGƒKƒ‰ƒjƒ“Œ‹‡j@Chain FiƒKƒ‰ƒjƒ“j‘I‘đ@mGalanin receptor - WikipediaCGalanin - Wikipedian
ƒJƒ‹ƒVƒgƒjƒ“Žó—e‘Ě 5uz7iƒyƒvƒ`ƒhƒŠƒKƒ“ƒh‚¨‚ć‚ŃGƒżsƒŔƒÁƒ^ƒ“ƒpƒNŽż‚Ć•Ą‡‘Ě‚đŒ`Ź‚ľ‚˝ƒJƒ‹ƒVƒgƒjƒ“Žó—e‘́j@Chain RiƒJƒ‹ƒVƒgƒjƒ“Žó—e‘́j‘I‘đ@mCalcitonin receptor - Wikipedian
ƒJƒ‹ƒVƒgƒjƒ“ˆâ“`ŽqŠÖ˜Aƒyƒvƒ`ƒhiCGRPjŽó—e‘Ě 6e3yiCGRPŽó—e‘́GŽó—e‘ĚŠˆŤ’˛ßƒ^ƒ“ƒpƒNŽż1qRAMP1rCƒiƒmƒ{ƒfƒB35‚¨‚ć‚ŃGsƒ^ƒ“ƒpƒNŽżƒwƒeƒ3—Ę‘Ě‚Ć‚Ě•Ą‡‘́j@Chain PiƒJƒ‹ƒVƒgƒjƒ“ˆâ“`ŽqŠÖ˜Aƒyƒvƒ`ƒh1j‘I‘đ@¨ CGRPŠÖ˜A•ĘƒgƒsƒbƒN@mCalcitonin gene-related peptide - Wikipedian
ƒgƒƒ“ƒ{ƒLƒTƒ“A2Žó—e‘Ě 6iiuiƒgƒƒ“ƒ{ƒLƒTƒ“A2Žó—e‘́Gƒ‰ƒ}ƒgƒƒoƒ“Œ‹‡j@A8Xiƒ‰ƒ}ƒgƒƒoƒ“j‘I‘đ@“ŻPDBsumƒf[ƒ^6iiu_A8X$ a PDBsumƒf[ƒ^6iiv_A90iƒ_ƒ‹ƒgƒƒoƒ“j$@mThromboxane receptor - Wikipedian
ƒvƒƒeƒA[ƒ[ŠˆŤ‰ťŽó—e‘Ě 3vw7iƒvƒƒeƒA[ƒ[ŠˆŤ‰ťŽó—e‘Ě1qPAR1rGƒ{ƒ‰ƒpƒNƒT[ƒ‹qƒ{ƒ‰ƒpƒLƒTƒ‹rŒ‹‡j@“ŻPDBsumƒf[ƒ^3vw7_VPXiOLCœ‚­j$@mProtease-activated receptor - Wikipedian
ƒzƒ‹ƒ~ƒ‹ƒyƒvƒ`ƒhŽó—e‘Ě 7t6s‚ĚChain Riƒzƒ‹ƒ~ƒ‹ƒyƒvƒ`ƒhŽó—e‘́qFPR2rGcompound 43Œ‹‡j@“ŻPDBsumƒf[ƒ^7t6s_FUI$@mFormyl peptide receptor - Wikipedian
ƒ‚ƒ`ƒŠƒ“Žó—e‘Ě 8ibu‚ĚChain Riƒ‚ƒ`ƒŠƒ“Žó—e‘́qGPCR38rGƒGƒŠƒXƒƒ}ƒCƒVƒ“Œ‹‡j@“ŻPDBsumƒf[ƒ^8ibu_ERY$@mMotilin receptor - Wikipedian
ƒŠƒ]ƒzƒXƒtƒ@ƒ`ƒWƒ“Ž_Žó—e‘Ě 7yu3‚ĚChain RiƒŠƒ]ƒzƒXƒtƒ@ƒ`ƒWƒ“Ž_Žó—e‘Ě1qLPAR1rGONO-0740556Œ‹‡j@“ŻPDBsumƒf[ƒ^7yu3_K6LiONO-0740556j$@mLPAR1 - Wikipedian
ŒŒŠÇě“ŽŤ’°ŠÇƒ|ƒŠƒyƒvƒ`ƒhŽó—e‘Ě 6vn7‚ĚChain LERiŒŒŠÇě“ŽŤ’°ŠÇƒ|ƒŠƒyƒvƒ`ƒhŽó—e‘́qVIP1RrGƒyƒvƒ`ƒhPACAP27Œ‹‡j@Chain LiPACAP27j‘I‘đ@mVasoactive intestinal peptide receptor - Wikipedian
_Œoƒyƒvƒ`ƒhYiNPYjŽó—e‘Ě 5zbqiUR-MK299‚ŞŒ‹‡‚ľ‚˝_Œoƒyƒvƒ`ƒhY1Žó—e‘́j@“ŻPDBsumƒf[ƒ^5zbq_9AO$ a @PDBsumƒf[ƒ^5zbh_9AF$iBMS-193885Œ‹‡j@mNeuropeptide Y receptor Y1 - WikipediaCNeuropeptide Y - Wikipedian

5tvn@¨ JmolƒgƒsƒbƒN@m‰E’[}n•ĘŒ¤‹†‚Ě7srq‚ĚPDBsumƒf[ƒ^


œƒƒhƒvƒVƒ“ŠÖ˜A@¨ ƒ‚ƒm‚Í‚Č‚şŒŠ‚Ś‚é b ś‘Ě•ŞŽq–ÍŒ^ ƒEƒVƒƒhƒvƒVƒ“PDB 3PQR

ƒAƒ~ƒmF@ChainF@CPKF@a@JmolF@RasmolF a ”ZÔ@—΁@”Zƒsƒ“ƒN@žň
Ž_ŤE’†ŤE‰–ŠîŤ‹ć•Ę@‹ÉŤE”ń‹ÉŤ‹ć•Ę@‘a…ŤƒCƒ“ƒfƒbƒNƒX‡@I/O’l‡i“ÁŤŠî Rj@“™“d“_‡@ƒRƒ“ƒzƒ[ƒVƒ‡ƒ“‘I‘𐍁iƒżƒwƒŠƒbƒNƒXEƒŔƒXƒgƒ‰ƒ“ƒhj
…‘fŒ‹‡•\ŽŚ b S-SŒ‹‡•\ŽŚ@ b @
b ”wŒiE•@ŠD@”’@Ž
@Chain‘I‘đF A B C D E F G H I J K L M N O P
ŸƒƒhƒvƒVƒ“iƒƒhƒvƒVƒ“ƒtƒ@ƒ~ƒŠ[‚Í•Ę–źƒNƒ‰ƒXAGƒoƒ\ƒƒhƒvƒVƒ“Cƒ‹ƒ~ƒƒhƒvƒVƒ“‚ȂNJ܂ށj ¨ ƒ‚ƒm‚Í‚Č‚şŒŠ‚Ś‚é
1f88‚ĚChain A#iƒEƒVƒƒhƒvƒVƒ“j@Gly90‘I‘đ@Lys296‘I‘đ@“ŻPDBsumƒf[ƒ^1f88_RET$
1l9h‚ĚChain A#iƒEƒVƒƒhƒvƒVƒ“j@“ŻPDBsumƒf[ƒ^1l9h_RET[Chain A]$
2z73‚ĚChain A*iƒCƒJƒƒhƒvƒVƒ“j@“ŻPDBsumƒf[ƒ^2z73_RET$
3pqr#iƒƒ^ƒƒhƒvƒVƒ“IIj@PDBsum‚É‚ć‚郌ƒ`ƒi[ƒ‹‚ĚSITE‘I‘đ@Gly90‘I‘đ@Lys296‘I‘đ@“ŻPDBsumƒf[ƒ^3pqr_RET$ ¨ ś‘Ě•ŞŽq–ÍŒ^Kawakami Model
4pxfiƒEƒVƒƒhƒvƒVƒ“GƒIƒNƒ`ƒ‹-ƒŔ-D-ƒOƒ‹ƒRƒVƒh‚¨‚ć‚ŃGPCR‹¤–đ§Œäƒ^ƒ“ƒpƒNŽżƒtƒ@ƒ~ƒŠ[‚ĚƒAƒŒƒXƒ`ƒ“kB˝l‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^4pxf_BOG406$@BOG_406A‘I‘đ@mArrestin - Wikipedian
4ww3‚ĚChain AiƒCƒJƒƒhƒvƒVƒ“j@“ŻPDBsumƒf[ƒ^4ww3_RET$
4zwj‚ĚChain AiƒƒhƒvƒVƒ“‚ĆƒAƒŒƒXƒ`ƒ“‚ĚƒLƒƒ‰ƒ^ƒ“ƒpƒNŽżGƒtƒFƒ€ƒg•bXüƒŒ[ƒU[‚É‚ć‚éj@¨ JmolƒgƒsƒbƒN
5azd‚ĚChain AiD”MŤƒƒhƒvƒVƒ“j
5dysiƒƒhƒvƒVƒ“Gć“VŤ’âŽ~Ť–é–ӏǁqCSNBr‚ÉŠÖŒW‚ˇ‚éT94I•ĎˆŮ‘́j@“ŻPDBsumƒf[ƒ^5dys_RET$ b 5en0i“Żj@“ŻPDBsumƒf[ƒ^5en0_RET$
5te3iƒEƒVƒƒhƒvƒVƒ“GƒIƒNƒ`ƒ‹-ƒŔ-D-ƒOƒ‹ƒRƒVƒh‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^5te3_BOG[411(A)]$@BOGiƒƒhƒvƒVƒ““ŕ‚ĚƒŔ-octylglucosidej‘I‘đ b 5te5@“ŻPDBsumƒf[ƒ^5te5_7AB$
6fk6iƒEƒVƒƒhƒvƒVƒ“GS-RS01‚ŞŒ‹‡j@DOKiS-RS01j‘I‘đ@BOGiƒƒhƒvƒVƒ““ŕ‚ĚƒŔ-octylglucosidej‘I‘đ@“ŻPDBsumƒf[ƒ^6fk6_DOK$ b PDBsumƒf[ƒ^6fk7_DO5iRS06Œ‹‡j$ b PDBsumƒf[ƒ^6fk8_DNZiRS08Œ‹‡j$ b PDBsumƒf[ƒ^6fk9_DNKiRS09Œ‹‡j$ b PDBsumƒf[ƒ^6fka_DN5iRS11Œ‹‡j$ b PDBsumƒf[ƒ^6fkb_DLHiŒ‹RS13‡j$ b PDBsumƒf[ƒ^6fkc_DLBiRS15Œ‹‡j$ b PDBsumƒf[ƒ^6fkd_DL2iRS16Œ‹‡j$
6pgsiƒEƒVƒIƒvƒVƒ“j@64ZiƒQƒ‰ƒjƒI[ƒ‹j‘I‘đ@Chain BiG alpha CT2 peptidej‘I‘đ@“ŻPDBsumƒf[ƒ^6pgs_64Z$ b PDBsumƒf[ƒ^6ph7_NZZiƒlƒ[ƒ‹Œ‹‡j$
7mt9‚ĚModel 1iƒƒhƒvƒVƒ“GGPCR“ÁˆŮ“IƒLƒi[ƒ[ GRK1‚ŞŒ‹‡j@mRhodopsin kinase - Wikipedian
8a6e‚ĚChain AiƒEƒVƒƒhƒvƒVƒ“j@“ŻPDBsumƒf[ƒ^8a6e_RET$
1e0p‚ĚChain AiŠî’ęó‘ԁjiƒoƒNƒeƒŠƒIƒƒhƒvƒVƒ“j@“ŻPDBsumƒf[ƒ^1e0p_RET$
1h2siƒZƒ“ƒ\ƒŠ[ƒƒhƒvƒVƒ“IIj@Chain A@“ŻPDBsumƒf[ƒ^1h2s_RET$@mSensory rhodopsin II - Wikipedian
7vgv‚ĚChain CiŒő‹ě“ŽŒ^ƒCƒIƒ“ƒ|ƒ“ƒvƒƒhƒvƒVƒ“NM-R3j@Asn98EThr102ETrp201EAsp231‹óŠÔ[“U^ƒż’Y‘fƒ‰ƒxƒ‹•\ŽŚ@“ŻPDBsumƒf[ƒ^7vgv_RET[301(A)]$
1r2n‚ĚModel 1*iƒoƒNƒeƒŠƒIƒƒhƒvƒVƒ“j@“ŻPDBsumƒf[ƒ^1r2n_RET$
2z55‚ĚChain A*#iƒA[ƒLƒƒhƒvƒVƒ“CƒoƒNƒeƒŠƒIƒ‹ƒxƒŠƒ“j@“ŻPDBsumƒf[ƒ^2z55_RET$
4qid‚ĚChain Ai‚“xD‰–‹ŰHaloquadratum walsbyi‚ĚƒoƒNƒeƒŠƒIƒƒhƒvƒVƒ“j@“ŻPDBsumƒf[ƒ^4qid_RET$@mHaloquadratum - Wikipedian
4qryiƒnƒƒƒhƒvƒVƒ“j@A-C˝‘I‘đ@E-G˝‘I‘đ@BR‚ĆRETiBr-‚ĆƒŒƒ`ƒi[ƒ‹j‘I‘đ@“ŻPDBsumƒf[ƒ^4qry_RET$@ƒ^ƒ“ƒpƒNŽżiLysj‘I‘đ@¨ JmolƒgƒsƒbƒN
5b6viƒoƒNƒeƒŠƒIƒƒhƒvƒVƒ“GŒőĆŽË‘Oj b 5b6yi“ŻGŒőĆŽËŒă36.2 ƒĘsj a ˆČ‰şPDBsumƒf[ƒ^iƒŠƒKƒ“ƒh‚ÍRETjF 5b6viŒőĆŽË‘Oj@5b6wiŒőĆŽËŒă16 nsj@5h2hi40 nsj@5h2ii110 nsj@5h2ji290 nsj@5b6xi760 nsj@5h2ki2 ƒĘsj@5h2li5.25 ƒĘsj@5h2mi13.8 ƒĘsj@5b6yi36.2 ƒĘsj@5h2ni95.2 ƒĘsj@5h2oi250 ƒĘsj@5h2pi657 ƒĘsj@5b6zi1.725 msj
5kkh‚ĚChain AiƒoƒNƒeƒŠƒIƒƒhƒvƒVƒ“j@“ŻPDBsumƒf[ƒ^5kkh_RET$
6csm‚ĚChain Aiƒ`ƒƒƒlƒ‹ƒƒhƒvƒVƒ“GtACR1j@mChannelrhodopsin - Wikipedian@“ŻPDBsumƒf[ƒ^6csm_RET$
6csniƒ`ƒƒƒlƒ‹ƒƒhƒvƒVƒ“iC++Gat pH8.5j@“ŻPDBsumƒf[ƒ^6csn_RET$ b PDBsumƒf[ƒ^6cso_RETiat pH6.5j$
7e70iƒ`ƒƒƒlƒ‹ƒƒhƒvƒVƒ“j@“ŻPDBsumƒf[ƒ^7e70_RETi250 ms structurej$ b “ŻPDBsumƒf[ƒ^7c86_RETidark state structurej$
6jo0iƒEƒCƒ‹ƒXŒ^ƒƒhƒvƒVƒ“j@PDBsumƒf[ƒ^6jo0_RETiat pH6.5j$
6guxiƒA[ƒLƒƒhƒvƒVƒ“3qarchaerhodopsin-3rj@“ŻPDBsumƒf[ƒ^6gux_RETsiƒŒƒ`ƒi[ƒ‹‚ÍA\‘˘CHŒ´Žq•t‰Áj$ b PDBsumƒf[ƒ^6guy_RET$@PDBsumƒf[ƒ^6guz_RET$@mArchaerhodopsin - Wikipedian
6is6iƒwƒŠƒIƒƒhƒvƒVƒ“j@Lys238iƒŒƒ`ƒi[ƒ‹‚ŞŒ‹‡j‘I‘đ@“ŻPDBsumƒf[ƒ^6is6_RETi1-ƒIƒŒƒIƒCƒ‹-R-ƒOƒŠƒZƒ[ƒ‹‚ŞŒ‹‡j$@mHeliorhodopsin - Wikipedian@¨ JmolƒgƒsƒbƒN
6lm0‚ĚChain AiƒVƒAƒmƒƒhƒvƒVƒ“j
7e4g‚ĚChain AiƒVƒ]ƒƒhƒvƒVƒ“4j@“ŻPDBsumƒf[ƒ^7e4g_RET$

ś‘Ě•ŞŽq–ÍŒ^ ƒEƒVƒƒhƒvƒVƒ“PDB 3PQR

5dysE5en0‚ĚPDBsumƒf[ƒ^i1f88E3pqrm¨ ƒ‚ƒm‚Í‚Č‚şŒŠ‚Ś‚én‚Ć‚Ě”äŠrj
Structural role of the T94I rhodopsin mutation in congenital stationary night blindnessiPrimary Citation of Related StructuresC2016/07/25j


mBacteriorhodopsin - Wikipedian

mśE’†n“ŻPDB 5b6v‚Ě‘S‘̍\‘˘‚¨‚ć‚Ń“Żƒf[ƒ^‚Ć5b6y‚ĚPDBsumƒf[ƒ^
Ž‹Šo‚ÉŠÖ‚í‚éƒ^ƒ“ƒpƒNŽż‚Ě’´‚‘Ź•ŞŽq“Ž‰ć |”–ˆĂ‚˘‚Ć‚ą‚ë‚ĹŒő‚đŠ´‚ś‚éŽd‘g‚݁|iSPring-8C2023/03/23jŽQĆ

ŚŽQl2i”ńGPCRjFƒEƒCƒ‹ƒXŒ^ƒƒhƒvƒVƒ“6jo0‚¨‚ć‚ŃƒA[ƒLƒƒhƒvƒVƒ“3 6guxi‚ą‚ę‚Ě‚ÝHŒ´Žq•t‰ÁjE6guyE6guz‚ĚPDBsumƒf[ƒ^


ƒAƒ~ƒmF@ChainF@CPKF@a@JmolF@RasmolF a ”ZÔ@—΁@”Zƒsƒ“ƒN@žň
Ž_ŤE’†ŤE‰–ŠîŤ‹ć•Ę@‹ÉŤE”ń‹ÉŤ‹ć•Ę@‘a…ŤƒCƒ“ƒfƒbƒNƒX‡@I/O’l‡i“ÁŤŠî Rj@“™“d“_‡@ƒRƒ“ƒzƒ[ƒVƒ‡ƒ“‘I‘𐍁iƒżƒwƒŠƒbƒNƒXEƒŔƒXƒgƒ‰ƒ“ƒhj
…‘fŒ‹‡•\ŽŚ b S-SŒ‹‡•\ŽŚ@ b @ b ”wŒiE•@ŠD@”’@Ž
@Chain‘I‘đF A B C D E F G H I J K L M N O P
1omw#iGƒ^ƒ“ƒpƒNŽż‹¤–đŽó—e‘ĚƒLƒi[ƒ[2qGRK2r-ƒwƒeƒŽO—Ę‘ĚGƒ^ƒ“ƒpƒNŽż•Ą‡‘́GLefkowitz‚É‚ć‚éj@mG protein - WikipediaCG protein-coupled receptor kinase - Wikipedian
4l9i‚ĚChain AiGƒ^ƒ“ƒpƒNŽż‹¤–đŽó—e‘ĚƒLƒi[ƒ[1qGRK1rGƒpƒƒLƒZƒ`ƒ“‚ŞŒ‹‡j@“ŻPDBsumƒf[ƒ^4l9i_8PR$
4kfm‚Ě12—ʑ́iGƒ^ƒ“ƒpƒNŽżˆË‘śŤ“ŕŒü‚ŤŽ—ŹK+ƒ`ƒƒƒlƒ‹GIRK2-Gƒ^ƒ“ƒpƒNŽżƒŔƒÁ•Ą‡‘́GChain AEBEG~4j@mG protein-coupled inwardly-rectifying potassium channel - Wikipedian ¨ NatureƒnƒCƒ‰ƒCƒgi2013/06/13j

yŽQlzNatureƒŒƒrƒ…[ Fig.3(b)ŒfÚ‚ĚGPCR

2008@2z73(A) b 2vt4(A) b 3eml
2010@3pbl(A) b 3odu(A)
2011@3sn6(R) b 3qak b 3rze b 3pqr
2012@3v2y b 3uon b 4daj(A) b 3vw7 b 2lnl(Model 1)
@@4djh(A) b 4dkl b 4ea3(A) b 4ej4 b 4grv

uśŠˆŠÂ‹Ť‰ťŠw‚Ě•”‰Žvƒz[ƒ€ƒy[ƒW b Jmol”Łu•ŞŽq‚ĚŠwK’ v b Chime”Łu•ŞŽq‚ĚŠwK’ v